SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023D6P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023D6P0
Domain Number - Region: 24-72
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.093
Family Regulator of G-protein signaling, RGS 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023D6P0
Sequence length 166
Comment (tr|A0A023D6P0|A0A023D6P0_ACIMT) Uncharacterized protein {ECO:0000313|EMBL:GAJ29827.1} KW=Complete proteome; Reference proteome OX=1231351 OS=Acidomonas methanolica NBRC 104435. GN=Amme_083_002 OC=Acetobacteraceae; Acidomonas.
Sequence
MKIEIDLNDILGDEYGAETLQESVKRQVIEHLSSSVEKDIKKRISEETNRILQEELQSAV
KEKMPALIDDLLTAEYVPTDRYGRTEKATTLCSELIRVVSENMVYKKGSYRSENNAFTNA
VDAVIEAQVDGFKKEFVAKVDASFKAEALRVATQSILAKLGVPQSA
Download sequence
Identical sequences A0A023D6P0
WP_042060162.1.97093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]