SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023D9Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023D9Q5
Domain Number 1 Region: 98-278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.02e-39
Family Nitrogenase iron protein-like 0.075
Further Details:      
 
Domain Number 2 Region: 26-67
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000708
Family Eukaryotic type KH-domain (KH-domain type I) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023D9Q5
Sequence length 320
Comment (tr|A0A023D9Q5|A0A023D9Q5_9BACI) Putative PhoH-like protein {ECO:0000313|EMBL:GAJ38113.1} KW=Complete proteome; Reference proteome OX=1220594 OS=Parageobacillus caldoxylosilyticus NBRC 107762. GN=GCA01S_001_00570 OC=Parageobacillus.
Sequence
MLEEFVTISQQLENANEAIALFGIHDAHLKRLEEELGVSIVTRGETVSVSGTPEQVQLVD
DLLRHLLIIIRKGITISERDVMYAIQLAKKGALDYLVSLYEEEITKNAKGKPIRVKTLGQ
RHYVTAIKQHDLVFGIGPAGTGKTYLAVVMAVRALKNGQVKRIILTRPAVEAGESLGFLP
GDLKEKVDPYLRPLYDALHDVLGVDHTQRLIERGTIEIAPLAYMRGRTLEDAFVILDEAQ
NTTPAQMKMFLTRLGFGSKMVITGDISQVDLPKGVKSGLAVAKEILATISGVSFVFLEQS
DVVRHPLVAKIIEAYNQAGL
Download sequence
Identical sequences A0A023D9Q5 A0A150LK17 A0A1V9B3F5
WP_017435633.1.16797 WP_017435633.1.49028 WP_017435633.1.80066 WP_017435633.1.9608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]