SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023DH85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023DH85
Domain Number - Region: 6-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000123
Family Ubiquitin-related 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023DH85
Sequence length 79
Comment (tr|A0A023DH85|A0A023DH85_9BACI) Putative type VII secretion protein {ECO:0000313|EMBL:GAJ40640.1} KW=Complete proteome; Reference proteome OX=1220594 OS=Parageobacillus caldoxylosilyticus NBRC 107762. GN=GCA01S_048_00070 OC=Parageobacillus.
Sequence
MYIQVTIDLRHYTEDVFDLRLSNFYSIKKLIDIVWQLKNISAPPREGYWVRVDNKQMVCP
GYFTLKDSGITDGDRIVIL
Download sequence
Identical sequences A0A023DH85 A0A150L663 A0A1B7KQN9 A0A1I0T7H6 A0A1V9AT05
WP_017435737.1.16797 WP_017435737.1.19223 WP_017435737.1.49028 WP_017435737.1.56329 WP_017435737.1.80066 WP_017435737.1.9608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]