SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023EDB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023EDB7
Domain Number - Region: 33-63
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00968
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023EDB7
Sequence length 78
Comment (tr|A0A023EDB7|A0A023EDB7_AEDAL) Putative histone h3 lys4 methyltransferase complex subunit {ECO:0000313|EMBL:JAC06841.1} OX=7160 OS=Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MMEKENKSTNDNGRKPSGRDLQSLPTRQYLDQTVNPILLQGLKALAKERPQDPVQYLANF
LMKNKSRVDESNGGTEEG
Download sequence
Identical sequences A0A023EDB7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]