SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023EFA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023EFA0
Domain Number 1 Region: 29-149
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-27
Family C-type lectin domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023EFA0
Sequence length 150
Comment (tr|A0A023EFA0|A0A023EFA0_AEDAL) Putative c-type lectin {ECO:0000313|EMBL:JAC08078.1} OX=7160 OS=Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MQFQTIVSAVIAQLLLASLVADSAKLPFNKYVIMDDKVTFFEAWRSCQYYGLQLASVTSS
EDNQQLSKLMNRSARGNDTFWLAGTDVGREGKWVWITTNKLVLHFSNWGSISPLFAEVND
CMAIGSFTEDRTLWDDIPCSEAHKYVCQKV
Download sequence
Identical sequences A0A023EFA0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]