SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023EJU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023EJU7
Domain Number 1 Region: 8-210
Classification Level Classification E-value
Superfamily L domain-like 7.48e-36
Family Internalin LRR domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023EJU7
Sequence length 216
Comment (tr|A0A023EJU7|A0A023EJU7_AEDAL) Putative membrane glycoprotein lig-1 {ECO:0000313|EMBL:JAC09352.1} OX=7160 OS=Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
VQSLDVKLFSKQLRLEALELTGMMLRNLPVGIFDNLVDLRLLDLSRNQLSEMDNNIFEHL
FSLKELSLSDNGITSLNAALFHGLKNLKVIDLSENELTAIDPELFRDCLNLRTLYLSSNR
FSAFDLSKMSIAKTLEELDISQNMLSSLVITEELYDMIADDNQISSITVDESPAYNLETL
SLSNNRLSDITPILRFSNLESLNISRNDLQNFDLDG
Download sequence
Identical sequences A0A023EJU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]