SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023EKU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023EKU4
Domain Number - Region: 123-185
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0451
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023EKU4
Sequence length 242
Comment (tr|A0A023EKU4|A0A023EKU4_AEDAL) Putative mediator of cell motility 1 {ECO:0000313|EMBL:JAC09806.1} OX=7160 OS=Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
GACGAWAYRQISPAVVKRVFILGPSHHVRLSRCALSAAQYCRTPLYDLKVDQEINAELEA
TGHFKWMDQKTDEDEHSIEMHLPYVAKVMEDFRDQFTIVPIMVGSISNDWEETYGKILAP
YLADPQNLFVISSDFCHWGARFRYTYYEDSHGPIYKWIEVLDKMGMDLIETLKPESFGEY
LRKYNNTICGRHPIGVLLQSVEELKRRGYRMSFKFLKYDQSNQCCDKKDSSVSYASGSLI
FE
Download sequence
Identical sequences A0A023EKU4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]