SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023ERL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023ERL4
Domain Number 1 Region: 162-292
Classification Level Classification E-value
Superfamily TRAF domain-like 1.8e-19
Family MATH domain 0.0068
Further Details:      
 
Domain Number 2 Region: 12-106
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000000036
Family MATH domain 0.0064
Further Details:      
 
Domain Number 3 Region: 318-388
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000147
Family MATH domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023ERL4
Sequence length 403
Comment (tr|A0A023ERL4|A0A023ERL4_AEDAL) Putative e3 ubiquitin-protein ligase trim37 {ECO:0000313|EMBL:JAC11823.1} OX=7160 OS=Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
PLVSKQYTDTVGSRWRLNVYPLKGNNTNCRYLSTYVELCDGVAGRYQYIVELLHNDPDRQ
VKFQSEDDFRVGEIRGYQKFIRVKRVLEEGYLNDDGSIYIRLSIRPATLALRCQYQEEYQ
TLKEEKLLFQFNSQLSQHLTKIRTLREENSSLQSIAYPEYNSNIFVMRNFGSLRQNNEDI
CSDNSYDDLGCCWRLIVFPNGDKEGQDEWLSVYLRLLEGIPGSYEYCVELLHNDPIKTVK
MEGTQTFEIQERFGWTKFARLDMVCASGFINEEHDSLYFRFSLRPPNYKAKCEYQQLLKV
DAKRENEMLKRELIPAYSTITYTLRNFSEMQQKEGFVYSDPLVDDLGFTWRLLIYANGHN
EGRGCHLSVFLILFEGVTGSRFEYRVELLHRNPLANIKMEGGL
Download sequence
Identical sequences A0A023ERL4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]