SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023ETE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023ETE2
Domain Number 1 Region: 189-321
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.39e-27
Family Regulator of G-protein signaling, RGS 0.0019
Further Details:      
 
Domain Number 2 Region: 114-196
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000545
Family Regulator of G-protein signaling, RGS 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023ETE2
Sequence length 515
Comment (tr|A0A023ETE2|A0A023ETE2_AEDAL) Uncharacterized protein {ECO:0000313|EMBL:JAC12610.1} OX=7160 OS=Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
DGYDSLSYLSVDCDSISTYSENAFDDGTTTTDDVDHSCRTSNNCTPIPPALEVVLEEEKR
PAEDDDRKQILEVCNLTMRQSLTDDEKTQICASNKLKLEEPNPTPTSKDEGFNSLVNSDA
VRIYRKYLVSNSPCYIEMPATILSHISLALCGGSCSEEIFNEAQQYLVDVMEKSYLNAFL
ESSFYSKYTFEVLSSDSLTLKDILCSEMALFYFMEYLEQKGKRHILEFCVTASHFRRSAE
NSQAQADAVVLYEKYFSLQATCPLNVSDKIRFLVEEGICSQDAGTIKNCFEMPSRVIERF
LEKRYFQGFLKSQLYKQYLAELLGKIKTAGVGESTGSSMGILAGRKQIFFSDRNRTTNNQ
RRGHRKTFSDVTSERSGRAKQFVSSQNTLLAMSDTSFHRKRTNTVGTATGTDIMQIDSRQ
LYNPDLLWRRNSVAGLTFGRVDALGRYERDFDIVEPPQDDDRWSKNRLKKAMRKLVNLPE
DKAQEELAWQVAEMIVKDITSVTMSGGSEGSNAHT
Download sequence
Identical sequences A0A023ETE2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]