SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023EVY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023EVY4
Domain Number 1 Region: 219-396
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.19e-37
Family Regulator of G-protein signaling, RGS 0.000098
Further Details:      
 
Domain Number 2 Region: 427-490
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023EVY4
Sequence length 724
Comment (tr|A0A023EVY4|A0A023EVY4_AEDAL) Putative rhogef2 {ECO:0000313|EMBL:JAC13256.1} OX=7160 OS=Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MLEQEKKNRDNLIGSNKQGTPECTRAEANIKKLQEELAQVCGEALSATPPSAHINQSINK
KHRRIVSSPENISSKEFSDHSTAAAGSLVPRHQKTSSDSWDKRSQEITPPGTPPPPYLSS
SMIGSGVGSGHLHHDHTTAGDLATSNENLLHHHHHPHQYQRPAPAIPHQVAGATTTIVAA
QANVAQKPIISMEDDDVSDQESLVEEQGPFKSLSSLLEQAHSAHLAVFLNFVLSNSDPSP
LLFYLITALYKEGSIKDMRKWAYEIHSTFLVPGAPLLWPNVDESLAREIDDILQKENDKV
EFLRRVFLRSRNKARDYISTQLKDFQVKRTAGLGTMYGPSDQQLKLAHGDKVKEQRIVEE
TLLPKLQQYLEEIEKEAPKECPKKLALCAALSTVLQRFFVTRPNTGSPIDKVHHFVSREK
SFKSRLMSKHRKQDILGHNLRLQPYYEVTRCNHCQNILWGVSPQGYHCSNCELNIHRACA
KDLNECCPGPTPLKNDSSKITKLMEKISSRNHHQADRTRRHDDDGAGEDGMGVDRPTSIS
LARQPSDRRQDFNNSSYLGGSNVSSYTDYLSNSTGDPDTFAPGGVDNDQFRESVKSKSAP
VSVNRSESYKERSQKKTRNTRRKTSDPSLTKTTDEQNEASSLINNNYSSSSTSSLPLALD
SRSTSLEAVGGPAGGASAGPGAPPGSAVPCVNTSAGNSSGLFGSPGGPNVANLSGFGGTT
ILLP
Download sequence
Identical sequences A0A023EVY4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]