SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023F224 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023F224
Domain Number 1 Region: 570-628
Classification Level Classification E-value
Superfamily BPTI-like 1.36e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0024
Further Details:      
 
Domain Number 2 Region: 375-423
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000196
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 448-502
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000379
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 512-565
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000111
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 642-689
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000034
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023F224
Sequence length 703
Comment (tr|A0A023F224|A0A023F224_TRIIF) Putative spondins extracellular matrix {ECO:0000313|EMBL:JAC15116.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
FQLQCPKFPDGKFNENVFIEIIGNPKLFIPGSVYTVNIKSEYNFEKFIITLDAGNGGGSL
QILNSREAVFAEDCLSTVVERSVRARNQIQILWTSPRYGCATIKVAIKIDNDWRINSKTL
CSDIKEQTEKKPECCTCDHARYKITFEGLWSPETHPKDFPTSLWLTHFSDVIGATHGPNF
TMWAEGGLASYGLKQLAEYGIVREMENELRLQSSKLRSIVKAAGLWHPNLNGRTWAVLRV
DPRRHLLSLASMFGPSPDWIVGISSLNLCLENCTWLESLEIDLYPYDAGTDSGRTYMSIK
TATDPPERIRRITTKFPDDPRSPFYNPNSDEMPPLAKLFIERDQIITKLCTDLTEQELLE
QVSESENTEDEDRPECAVTEYSSWSECSVTCGKGLRMRTRNYITPAKAKQKKCDRQLVSK
EMCTAAEQRCPGEMDDEEEVQPLVGAGECEVTDWSDWSECSVTCGIGVKLRSRSFISAEP
NIIKKCMHITTTEMEKCMLPQCHLNEKKISRACSVTEWSIWSPCSVTCGTGITSRVRKFL
SSKPPSSCYHQVNLSQNLTCTAPNCTINQNQYKEICSHEPQYGPCRGNFTRWAYSQDKQV
CETFLYGGCRGNKNNFMTEDECKAICQPATTKKSEEKQVAAVNCVVSKWSNWSFCLPCTN
GTKTKTRTIVKEPRNGGRPCPALSKTIKCSVPKDFCDLMNSYK
Download sequence
Identical sequences A0A023F224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]