SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023F385 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023F385
Domain Number 1 Region: 272-403
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-38
Family Regulator of G-protein signaling, RGS 0.0000298
Further Details:      
 
Domain Number 2 Region: 4-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.61e-27
Family DEP domain 0.0045
Further Details:      
 
Domain Number 3 Region: 210-262
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000209
Family Transducin (heterotrimeric G protein), gamma chain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023F385
Sequence length 753
Comment (tr|A0A023F385|A0A023F385_TRIIF) Putative regulator of g-protein signaling 7 {ECO:0000313|EMBL:JAC15875.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
RPFAFRKMEALVKQMQDPETGVPVRSQKIFLTSIPSAFIGYDLIEWLMEHLNIDESGEAV
HLANQLCQYGYLFPVTDCKTLTVKDDNSLYRFQAAYYWPWHHRNPDNVEYAIYLVKRTLR
NKQRHALEDYEIDALNSLKRNLQNKWEIVMMQAEEQVKVGKERKKMDKLVADSQERAYWR
VHRPPPGCQPPLEPSPITTLRRCINPLPLTTQIEILKRQVLKSRVKLSQAIEGLVTYSNT
YAEYDPLFTQPQPSNPWLSDDPSLWQFNQSIVEVPTEKRVKRWALSFEDLLADPTGVAEF
TNYLRKEYSHENIRFWLAVKELRHCAQSQVPVKVNSIYQEFLAHGAPCEINIDSKTQETT
LNEMKNPSRFTFDAAAHHVYNALLNKDCYPRFIRSDQYKCLLANALHPPIKKRFFGFGGG
GKKKSCTGTVAAVASKRRGSDRSLSGVIHETSFTNQMQVPISTSQSNLQDIATNRDSSVS
PERSTPTHKELKQKSVEHKQLSEDERHTGDISMQLEPGPSFVKTEPVITAETEELVELIL
PDNHSWGNATTSEGTRIKKIDEIDLQNKDNKYSSNSYTVPLNQENVVSAVTSEDKGKELS
ETTEFSSHTICAVGDKIKNEGCESPIPEQKLCSVFNKVLEVSSENLVESKLLSLDSPNLK
RFSQISENTEGVIVEKLQVDSPEEIKKDCNLPSIDVSNECPDKTVEVPGVEGVPEDLGTS
DSQRRADICPWEDEENCKTEEPFVKKYATLGYL
Download sequence
Identical sequences A0A023F385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]