SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023F428 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023F428
Domain Number 1 Region: 73-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.06e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023F428
Sequence length 181
Comment (tr|A0A023F428|A0A023F428_TRIIF) Putative transcription factor neurod {ECO:0000313|EMBL:JAC15734.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
PTDEDEDDSTNYLKLSPSSKQRQESDSELSESEGTSRRGKGKRRCLLTSGNTVTNGGGVI
RRRRQGLTARERNLRRLESNERERMRMHSLNDAFEQLREVIPHVKMERKLSKIETLTLAK
NYIMALTNVICEMRGDEKPYTFLDVDCSENSNGTEDLEQNNNSLFQENLETTPAQDIFSV
Q
Download sequence
Identical sequences A0A023F428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]