SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023F920 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023F920
Domain Number 1 Region: 10-101
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-21
Family Ankyrin repeat 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023F920
Sequence length 242
Comment (tr|A0A023F920|A0A023F920_TRIIF) Putative ankyrin repeat and dhhc-type zn-finger domain protein {ECO:0000313|EMBL:JAC17967.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
MDRQKVLEDNLRKAACEGDFDVVLEILSKGTNVNARHAINGWTALHWASRRGWKEIVRLL
LDHGADPTLVTENGETPLNLASNSDIRELLGGDMNGTANESTLPITPNYIKNPPLNTKED
YSHWGNGSLHRRQPPTQDTVEELVLKVRVANGGDPDFIEIELPRSELTYYSLLRVCCEEL
GLNASQVVRIRKLPNTMLRKDKDVQRLAQMQEIEVVVTPASLKHQPNGYKSIQLYKNQTI
LY
Download sequence
Identical sequences A0A023F920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]