SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FA94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023FA94
Domain Number 1 Region: 232-361
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.33e-34
Family cAMP-binding domain 0.0000504
Further Details:      
 
Domain Number 2 Region: 96-220
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.86e-34
Family cAMP-binding domain 0.0000148
Further Details:      
 
Domain Number 3 Region: 2-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000641
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023FA94
Sequence length 373
Comment (tr|A0A023FA94|A0A023FA94_TRIIF) Putative camp-dependent protein kinase types i and ii regulatory subunit {ECO:0000313|EMBL:JAC18397.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
GKIPVPDEFRTLLLEFTVTYLMEQPSDVVDFALDYFSRLKEIKTTQLVRPSSPDDSFSLE
EESMIPEKFNIRRKSVFAEAYNPEEDDDDAVKPQIYPKSDEQRQRLAESVKNILLFRSLD
QEQIIEVLDAMFIKDVKEGEYIIRQGDDGDNFYVIQNGIYNAYVLDNNQQEKLIHTYYNN
GSFGELALLYNMPRAATIKAGSDGSLWAMDRQTFRRIVLKSAFKKRKMYESLIECVPMLS
ALQSYESMNLADALIPKTYQDGECIIKQGDAADGMYFVENGHVKITIIGDNGKEVEIKRI
QKGEYFGELALVTHKPRAASAYAIGPVKVAFLDVEAFERLLGPCMQIMQRNINDYESQLV
KIFGSKNDITDMR
Download sequence
Identical sequences A0A023FA94 A0A069DTE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]