SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FCY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023FCY7
Domain Number 1 Region: 53-200
Classification Level Classification E-value
Superfamily Lipocalins 0.000000000000532
Family Retinol binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023FCY7
Sequence length 213
Comment (tr|A0A023FCY7|A0A023FCY7_9ACAR) Putative licpodalin-4 1 {ECO:0000313|EMBL:JAC19200.1} OX=34607 OS=Amblyomma cajennense (Cayenne tick). GN= OC=Amblyomma.
Sequence
GDADHAHTRFSIQAMKPRSMMIALTVVFCLIAVATSRPNAKPINPKRQLIKDLTNLNEKL
YIKQRNYRQNTTNRCHSAEKLSGSGDTYTYTLRFDLNAKRKALIAFNTTMNISTTPGHQE
PNAVTYKLGPKYPEKLRELLFINQKKNCAILLEHLDNGEIGCQLILPESTVDKEIPPKCL
KVYKEHCKGNTTVLYEQYCKNLTDTPYPPDGHC
Download sequence
Identical sequences A0A023FCY7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]