SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FDI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023FDI0
Domain Number - Region: 17-45
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0119
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023FDI0
Sequence length 83
Comment (tr|A0A023FDI0|A0A023FDI0_9ACAR) Uncharacterized protein {ECO:0000313|EMBL:JAC18799.1} OX=34607 OS=Amblyomma cajennense (Cayenne tick). GN= OC=Amblyomma.
Sequence
MVPASSCVMFVFGCLSVLVILPVAAVCAFTTEGQQWYLRNTHLFFTSGKCAIYAPPVFLR
TCCDIFLPTCWGTCLFLFYVIAL
Download sequence
Identical sequences A0A023FDI0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]