SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FFK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023FFK7
Domain Number - Region: 70-105
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0105
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023FFK7
Sequence length 121
Comment (tr|A0A023FFK7|A0A023FFK7_9ACAR) Putative histone h1-i-1 pediculus us corporis histone h1-i-1 {ECO:0000313|EMBL:JAC19448.1} OX=34607 OS=Amblyomma cajennense (Cayenne tick). GN= OC=Amblyomma.
Sequence
ELTAGDANDLAYQNSAAKTEVTDEVRAAADTVATGASENTXASADKENIGASLPKKSKMD
ADFHSLPTRQYLDQTVVPILLQALSTLAKERPPNPIEYLANYLMRNKAQFEHGSHSVNGQ
N
Download sequence
Identical sequences A0A023FFK7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]