SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FHP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023FHP5
Domain Number 1 Region: 13-137
Classification Level Classification E-value
Superfamily EF-hand 4.44e-39
Family Osteonectin 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023FHP5
Sequence length 142
Comment (tr|A0A023FHP5|A0A023FHP5_9ACAR) Putative reproduction {ECO:0000313|EMBL:JAC20278.1} OX=34607 OS=Amblyomma cajennense (Cayenne tick). GN= OC=Amblyomma.
Sequence
PLVDYYGACRELPKCLDEEMEDFPRRMREWLFNVMQDLARRHELNEPYKKLEEEAENLQS
RQWVNAVIWKFCELDSHPHDRAVSRHELFPLRAPLLSMEHCIAPFLNACDKDDDHTITLK
EWGDCLGLEDGEVQDRCAQITA
Download sequence
Identical sequences A0A023FHP5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]