SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FMV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023FMV8
Domain Number 1 Region: 90-156
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.07e-17
Family Tachycitin 0.01
Further Details:      
 
Domain Number 2 Region: 27-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000915
Family Tachycitin 0.034
Further Details:      
 
Domain Number 3 Region: 170-225
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000994
Family Tachycitin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023FMV8
Sequence length 245
Comment (tr|A0A023FMV8|A0A023FMV8_9ACAR) Putative cuticular protein analogous to peritrophins 3-e {ECO:0000313|EMBL:JAC22599.1} OX=34607 OS=Amblyomma cajennense (Cayenne tick). GN= OC=Amblyomma.
Sequence
ADRITAPPEMLLYATLIFVGLLCLGRCQCTTNGFFPHETQCDSYYECKNGTVVQGFCPDG
LVFNDEASYKHLRCDLPFDINCQNRPYLQPAQGVGNCPRRWGMYADEANCGKFYNCVDGK
GFPFDCPEGLAFNERRGVCDWPDLVERCDAEAYLGFQCPEPTAYELQDFVNPPYAHPRDC
AKHFVCVSTYYGKRLPRLLSCDEGTVFNPSTRTCDEPVNVPGCENYYGAQENPFNKGQTL
RRQGR
Download sequence
Identical sequences A0A023FMV8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]