SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FTE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023FTE8
Domain Number - Region: 33-65
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00916
Family MATH domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023FTE8
Sequence length 165
Comment (tr|A0A023FTE8|A0A023FTE8_9ACAR) Putative basic tail protein {ECO:0000313|EMBL:JAC23953.1} OX=34607 OS=Amblyomma cajennense (Cayenne tick). GN= OC=Amblyomma.
Sequence
MAILGLLCVFFLQAMHASADTVRGCPPQQVQEGTTVENCNFYCGKNDHDQWMMGYYPNGT
KCKYSDTQDGYCIEVPDNEGCHPENSQYVLDFFGHAPTAHTMPPTMATSKPKSSKSPKST
KKPKSTKKPKETKKPKETKNQRIRRKRNPRPRPLRLLTIGEELCE
Download sequence
Identical sequences A0A023FTE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]