SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023G1H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023G1H5
Domain Number - Region: 60-101
Classification Level Classification E-value
Superfamily BPTI-like 0.00533
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.058
Further Details:      
 
Domain Number - Region: 76-159
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0942
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023G1H5
Sequence length 187
Comment (tr|A0A023G1H5|A0A023G1H5_9ACAR) Putative secreted protein {ECO:0000313|EMBL:JAC28046.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
PFFLSLRSIDRAVSIYLALILFVLSLRSIGGVVSIDFANILFFLCSVSCTFGWLSDYKNM
SILNLKYVYNPSWRRCYLTFVKKTDRQSYTTRHACISACGTGQGAAFCVINRTHDCSSGP
DCETFYTYDVDSGKCKPVNSTFDILIEHYYDNIHETKWDCIRDCSGYTWEDIYGTEKKNK
NKSESDS
Download sequence
Identical sequences A0A023G1H5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]