SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023G685 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023G685
Domain Number 1 Region: 26-93
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000366
Family Thyroglobulin type-1 domain 0.0036
Further Details:      
 
Domain Number 2 Region: 101-149
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000301
Family Thyroglobulin type-1 domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023G685
Sequence length 264
Comment (tr|A0A023G685|A0A023G685_9ACAR) Putative thyropin {ECO:0000313|EMBL:JAC29324.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
NSACFALLCELQSFPLFLNTAHTGETDCQRRRRNEQRATRNLTGLLVPECDEHGEYKAMQ
CFGEAVRGRPFCACYDNEFGQIKGPSRQLRSCNCIREHHDWERSHRGSSRREGGPRCDTT
SGEYQPVQCTSTEHWCVDTDTGVQLGEKLHGGCSTDLSQVNCGIGGSHHGHGVGHGDSTH
RGASHDGSGSHHGEDSRRGSSSRHGDDTSDHGTSGSQSGSGSRGASGTRSRSSSSGSRSD
SGSRGSSSTSRNTDSESHRDSSHN
Download sequence
Identical sequences A0A023G685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]