SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023G6L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023G6L7
Domain Number - Region: 41-78
Classification Level Classification E-value
Superfamily FnI-like domain 0.0199
Family Fibronectin type I module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023G6L7
Sequence length 107
Comment (tr|A0A023G6L7|A0A023G6L7_9ACAR) Putative secreted protein {ECO:0000313|EMBL:JAC28505.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
MRPFVLCIIIFLSFVVLCSHGENAQGKTALDNSVKKGGKTSGGCTHNNDHIPEGKNRTVG
NPCVLVACAGGSTTVTNCSQVLRPEGEKFTGTAGNRRRGQEFPDCCE
Download sequence
Identical sequences A0A023G6L7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]