SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023G8N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023G8N9
Domain Number 1 Region: 754-903
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.02e-31
Family DBL homology domain (DH-domain) 0.0000182
Further Details:      
 
Domain Number 2 Region: 283-467
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-29
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 3 Region: 508-568
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023G8N9
Sequence length 1040
Comment (tr|A0A023G8N9|A0A023G8N9_9ACAR) Putative guanine nucleotide exchange factor {ECO:0000313|EMBL:JAC29213.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
NRLTPRNKQQCTNISYLTIKKMLEKEQAYLMQLLQEYGKTSSEKCQAEMQSARKRIAHLE
SQLLALRGSNPGSEAATVVGGAPRSRGNIEARRSTEGPEGLRSSSFHVAPHSSGGGAGRP
RSGPLASSASLENLSHALGPSPWSVPTHLRQRSSPETLLCTLEGPLGPVEEPPVGPSLDL
GLVPSSSCTDDPPLTPVRDPSEILEGWRGEDMAEDGDNTSEEGFLEGELPGLDDSLEGRP
LQYGTPPEVPPSGGRVPLQQSSILSMDDEERTSDTELTQLGDNGPFNNIWKLLRHPAHLA
VFLHYLLSNQSDPSSLLFLIITNLYKLGTGKEMKKWAYEITSTFLVQSAPLSIENIDETI
LKEIDKVLQSSQEQGQEEEELKDVFLKAREKAMEQLKRLLVDFRNTRTIGLSGLYMPNDV
TLDDSLRDKSVELRIVESLLLTELETLAKEDPENLTDYKSALASALATVLKSFGVKTPNA
VALMERFPTFVAREKSRIKFFPRNKKFAFQTIHTRGHHFQSQQYHCVTYCNHCQHIIWGV
GDQGYQCSNCEMNIHKTCVRVVEEQCIGSLMRHKKEKGKKNHRMSGVGLIEGIKTKARRP
NTRRGTQHSVDDWSGSLDAALPLDSSERGRPDTGDECEASTMGGAAELLDRGSTRKSSAT
AVGRSESFRQRRETRPSYRKRSDPNIPRSKSDVDVDDKPTNLNNSGSSSNSSLSTSRSLE
SPSQSWEAVHRSGEVPALGPLDDSDLEWDLEPPDWQATLGRETLRQLKPKEKKRQDVLNE
LFYTERSHVRTLKVLDRIFRRPLQQQELLAPELLQRLFPNLDELLRIHQGFSSLMKRRRA
QEPLIGDIGPMMLTMLDGESGERLQQAVATFCQHQSLALEALKARQKKDQKLAQFFGRCR
DAPAVSAAAAEGPGGSGLPAAHQVPAAHRERGEAQRPGLGRARAAAAGPAMFQAHPGARE
PGGARSRERPPLGRAAAAPRQELARQGGKPSSEPGVPAAGPEAAPIGARGPADDAAATPE
ASGRAAGAARRLAAGAAAPG
Download sequence
Identical sequences A0A023G8N9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]