SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023GC87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023GC87
Domain Number 1 Region: 32-134
Classification Level Classification E-value
Superfamily Cystatin/monellin 4.68e-19
Family Cystatins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023GC87
Sequence length 141
Comment (tr|A0A023GC87|A0A023GC87_9ACAR) Cystatin {ECO:0000256|RuleBase:RU362130} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
MASSFVLVAVFLGTCAFMCDGAPQGPPIPVVGGWQKKTPVDSEQYKELAHFAVSKQVEGR
EFFDTVLEVTDVETQVVAGTNYRITFKIAESTCRVTETYSKETCLPKTRDVKSTCTAVIT
EPLNHERFVHSFTCGGAAASK
Download sequence
Identical sequences A0A023GC87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]