SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023GD09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023GD09
Domain Number 1 Region: 58-167
Classification Level Classification E-value
Superfamily Lipocalins 0.0000000162
Family Retinol binding protein-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023GD09
Sequence length 188
Comment (tr|A0A023GD09|A0A023GD09_9ACAR) Putative lipocalin-2 1 {ECO:0000313|EMBL:JAC30838.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
MNTSSALSLAFLAAFFLVATTEAAKGPNVLQRDIPDAFQIFASFPYGVAITDIDNDEILD
CLTAKRKDFDPEAKTVTYVWSLNGGEGNKRKHVAFHHTAGATPDATNFTVGKDSDKVEVA
HFRYTDYKDCAIVEVPHFGDECVLFVSQEKENDVPASCMEQFSDICGEAISLRDKHVCVD
DKSEDEDY
Download sequence
Identical sequences A0A023GD09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]