SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023GE26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023GE26
Domain Number 1 Region: 21-189
Classification Level Classification E-value
Superfamily Lipocalins 0.000000018
Family Retinol binding protein-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023GE26
Sequence length 205
Comment (tr|A0A023GE26|A0A023GE26_9ACAR) Putative secreted protein {ECO:0000313|EMBL:JAC30960.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
MLSMFVGIYTITIQSLVLAVVPFEDNPQFFIHQHTSYVTDLNEGLIVLRQTSGPLLHPAT
PCQALRKIESAGTNAFRYQVYYTKPFPPHVITSFTTTMTTSITALHRHSNVIIYQTMEDG
PFTPFKVMYAHVPSGCFIFVYNLREYGRACRLLRRARRASDRIPHHCWQVYRGNCPEDDL
QIYMKHCAKAISHMSLQHLRTPQSL
Download sequence
Identical sequences A0A023GE26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]