SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023GH40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023GH40
Domain Number 1 Region: 8-147
Classification Level Classification E-value
Superfamily L domain-like 4.42e-29
Family U2A'-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023GH40
Sequence length 250
Comment (tr|A0A023GH40|A0A023GH40_9ACAR) Putative leucine-rich acidic nuclear protein {ECO:0000313|EMBL:JAC33189.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
MEKRIELEKRGKNPEQIHELNLDNCRSTAIVGLTEEFVNLETLSLINVGLTSLKGFPKLP
NLKKLELSDNRISGGLNLLHGSPKLTHLNLSGNKIKGLETLDPLKEFKNLKNLDLFNCEV
TSIENYRNRVFELIPSLKYLDGYDQDEKEAEDSEVDDEDGNEEDDEENEVDGEGESDEDD
EDDVNVDDEDDEDGEEDDDVDEEDGEDGEEEEGXXGDFYNPYDVDDDEDGDENESPKGQK
RKREEEDGED
Download sequence
Identical sequences A0A023GH40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]