SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023GHK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023GHK4
Domain Number 1 Region: 2-150
Classification Level Classification E-value
Superfamily EF-hand 3.13e-43
Family Calmodulin-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023GHK4
Sequence length 151
Comment (tr|A0A023GHK4|A0A023GHK4_9ACAR) Putative calmodulin {ECO:0000313|EMBL:JAC32468.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
MDDLTKEQVQMLRKAFDMFDRDKKGYVHTNMVSAILRTLGQTFEEKDLKDLIAEIDQDGS
GELEFEEFVALAARFLVEEDSEAMQEELREAFRLYDKEGNGYINVSDLREILRALDDALT
EDELDEMIAEIDTDGSGTVDFDEFMEMMTGD
Download sequence
Identical sequences A0A023GHK4 G3MP43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]