SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023GJI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023GJI4
Domain Number 1 Region: 106-230
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.19e-33
Family cAMP-binding domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 241-371
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.45e-31
Family cAMP-binding domain 0.0000576
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000327
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023GJI4
Sequence length 381
Comment (tr|A0A023GJI4|A0A023GJI4_9ACAR) Putative camp-dependent protein kinase types i and ii regulatory subunit {ECO:0000313|EMBL:JAC34041.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
MNRPRYDVPPELTNLLLEFTVNVMIERPSDLVEYAARYFSGLRDERQRSASSGRPPAIAE
NDEAIYSDEDEPMPKPPNRFSRRKSVFAEHYDPAEDEDDEASKVVHPKSDEQREKLSQAV
KNILLFKSLDVPQMQEVIDAMFERKVKPGDVVIKQGDDGDNFYVISSGTYEIFVNTDREQ
DKLVGKYEGSGSFGELALMYNMPRAATIKAVTEGSLWAMNRQTFRRIVLKSAFKKRKEYE
NLLEKVPMLKSLNSYERMNLCDALMPRSYKDELIIKQGDGADGMYFIEDGTVRICVKKDG
GNETEVSRISKGGYFGELALLTKKPRAASVYAVGAVKLAFLDVSAFERLLGPCKEIMMRN
IDQYEEQMIQAFGSKDVKDLR
Download sequence
Identical sequences A0A023GJI4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]