SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023GJS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023GJS9
Domain Number 1 Region: 10-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-27
Family Ankyrin repeat 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023GJS9
Sequence length 227
Comment (tr|A0A023GJS9|A0A023GJS9_9ACAR) Putative ankyrin repeat protein {ECO:0000313|EMBL:JAC33005.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
LCGDLTDAEKELYKAIQAGDVSEARTLLNRVRIECLDEHGMTPLQHAAYRGNYDLCKLFL
ECGADVNSHYHDSGYTALMFAGLAGRADVVSLLLEHGASTTAVNSLGRTAAQMAAFVSNH
DVVAIINNFLPREELEYYARPQGLDKEPKLPASLVSPLYQLIVRTNIHPVRVALYLQEKR
ELLDQSAKVERVLNLLCEKQMKAAEPNEMLALKFHHLAFLLRTCCKF
Download sequence
Identical sequences A0A023GJS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]