SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023HKU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023HKU4
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily EF-hand 9.61e-43
Family Calmodulin-like 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023HKU4
Sequence length 115
Comment (tr|A0A023HKU4|A0A023HKU4_9PEZI) Calmodulin {ECO:0000313|EMBL:AGM33821.1} OX=1326786 OS=Diaporthe sp. AR5149. GN=CAL OC=Diaporthe.
Sequence
KELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSEEEIREAF
KVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNEFVQL
Download sequence
Identical sequences A0A023HKC9 A0A023HKE0 A0A023HKE8 A0A023HKL3 A0A023HKQ7 A0A023HKU4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]