SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023J590 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023J590
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Histone-fold 4.19e-41
Family Nucleosome core histones 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023J590
Sequence length 105
Comment (tr|A0A023J590|A0A023J590_9EUPU) Histone H3 {ECO:0000256|RuleBase:RU004471} OX=1701732 OS=Caucasotachea vindobonensis. GN= OC=Stylommatophora; Sigmurethra; Helicoidea; Helicidae; Caucasotachea.
Sequence
ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP
FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCA
Download sequence
Identical sequences A0A023J541 A0A023J543 A0A023J544 A0A023J563 A0A023J564 A0A023J590 A0A023J592 A0A023J5C6 A0A023J5G1 A0A059NTR5 A0A059NTR6 A0A059NTR8 A0A059NTR9 A0A059NTS9 A0A059NTT0 A0A059NTT1 A0A059NTT2 A0A059NTT3 A0A059NTU3 A0A059NTU4 A0A059NTU5 A0A059NTW4 A0A059NTW5 A0A059NTW6 A0A059NTW7 A0A059NTW8 A0A059NTX8 A0A059NTY0 A0A059NTY2 A0A0A7DQR3 A0A1I9QNP3 A0A1S5WVA5 C5MJS4 D8WYR2 F4ZCC9 T2BAM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]