SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023JAB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023JAB8
Domain Number 1 Region: 84-432
Classification Level Classification E-value
Superfamily gp120 core 1.57e-173
Family gp120 core 0.000000000283
Further Details:      
 
Domain Number 2 Region: 480-605
Classification Level Classification E-value
Superfamily Virus ectodomain 3.84e-58
Family Virus ectodomain 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023JAB8
Sequence length 802
Comment (tr|A0A023JAB8|A0A023JAB8_9HIV1) Envelope glycoprotein gp160 {ECO:0000256|SAAS:SAAS00936864} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVRGILRSWQQWWIWVSLGFWMFMICNVVGNLWVTVYYGVPVWREAKAPLFCASDAKGY
EREVHNIWATHACVPTDPNPQEMVLENVTENFNMWKNDMADQMHEDIISLWDQSLKPCVQ
MTPLCVTLDCDKKNKQYALFYRLDVVPLDHYRLINCNTSTITQACPKVTFDPIPIHYCAP
AGFAILKCNNKTFNGTGTCYNVSTVQCTHGIKPVVSTQLLLNGSLAEGEIMIRSENLTEN
HKTIIVHLNESIPIVCTRPDNNTRRRVRIGPGQTFYTNDIIGDIRRAHCSINSTAWNKTL
TLVAKKLREHFPNKTIDFKPPSGGDLEITTHSFNCRGEFFYCDTSRLFNNTYTQNITLPC
RIKQFINMWQKVGRAMYAPPIAGNITCNSSITGLLLVRDGGSNTTEIFRPAGGDMRDNWR
SELYKYKVVEVKPLGIAPTEAKRRVVEREKRAVGVGAVFLGFLGAAGSTMGAASLTLTVQ
ARQLLSGIVQQQSNLLKAIEAQQHLLQLTVWGIKQLQTRVLAMERYLRDQQLLGLWGCSG
KLVCTTAVPWNDSWSNKTLTDIWENMTWMQWDKEISNYTGIIYNLLEESQNQQEKNEKDL
LALDKWQNLWTWFDITNWLWYIKIFIMIVGGLIGLRIIFAVLSIINRVRQGYSPLSFQTL
TPITRGPDRLERIEEEGGEQDRDRSVRLVSGFLALVWDDLRSLCLFSYHRLRDSILIVAR
VVELLGRSSLRGLQRGWEALKYLGSLVQYWVLELKRSAISLFDTIAIAVAEGTDRIIEVI
QRICRAILNPPRRIRQGFEAAL
Download sequence
Identical sequences A0A023JAB8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]