SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023LV83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023LV83
Domain Number - Region: 12-52
Classification Level Classification E-value
Superfamily SH2 domain 0.0539
Family SH2 domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023LV83
Sequence length 90
Comment (tr|A0A023LV83|A0A023LV83_9INFA) Protein PB1-F2 {ECO:0000256|HAMAP-Rule:MF_04064, ECO:0000256|SAAS:SAAS00960288} KW=Complete proteome OX=1406666 OS=Influenza A virus (A/widgeon/Wisconsin/140/1980(H6N1)). GN=PB1 OC=Orthomyxoviridae; Influenzavirus A.
Sequence
MGREQDTPWTQSTEHINIQKRGNGQQTQKLEHPNLTQLMDHYLRIMSQVDMHKQTVSWKQ
WLSLKSPTQESLKTRVLKRWKLFNKQEWTS
Download sequence
Identical sequences A0A023LV83 A0A023LZK5 A0A023M180 A0A023M3S6 A0A023M439 A0A023M4A2 A0A023M4D2 A0A024D5U4 Q20SF1
Q20SF1_9INFA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]