SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023P658 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023P658
Domain Number 1 Region: 137-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.14e-57
Family AadK C-terminal domain-like 0.0000549
Further Details:      
 
Domain Number 2 Region: 1-134
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.23e-50
Family AadK N-terminal domain-like 0.0000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023P658
Sequence length 290
Comment (tr|A0A023P658|A0A023P658_9BACI) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:AHX18109.1} KW=Complete proteome OX=1330043 OS=Bacillus bombysepticus str. Wang. GN=CY96_08895 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRTEKEMLDLIINTAIEDERIRAVIMNGSRVNPNVKRDCFQDYDIMYVVNDIQSFTSNHN
WIHRFGEIMIVQMPEEMSLVPPDEDGKFPYLMQFMDGNRIDLTLVPVELIKKFVGQDSLS
KLLLDKDNCLEEFPPASDKDYLVKKPTEKEFLDCCNEFWWCSTNIAKGLWREELSYAKGM
LEGPVRDMFIVMLEWYIGMKTDFTVNTGKFGKHFEQYIEEDMWEQFKRTFSNAEYENIWD
SFFVMGDLFREVANEIANTYEYQYPQDDDDKVTNYLKHVKALPKDSTSIY
Download sequence
Identical sequences A0A023P658 A0A0K0S6H1 A0A0U0N3Y6 A0A135X0H4 A0A242Z8C6 A0A2A8MC82 J7WDL3
WP_001258503.1.26872 WP_001258503.1.27931 WP_001258503.1.35694 WP_001258503.1.45720 WP_001258503.1.51681 WP_001258503.1.54142 WP_001258503.1.60841 WP_001258503.1.61243 WP_001258503.1.66999 WP_001258503.1.6816 WP_001258503.1.71242 WP_001258503.1.72484 WP_001258503.1.77567 WP_001258503.1.81570 WP_001258503.1.869 WP_001258503.1.90466 WP_001258503.1.94308 WP_001258503.1.97082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]