SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023P6L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023P6L3
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.85e-24
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023P6L3
Sequence length 143
Comment (tr|A0A023P6L3|A0A023P6L3_9BACI) Cell wall assembly protein {ECO:0000313|EMBL:AHX19062.1} KW=Complete proteome OX=1330043 OS=Bacillus bombysepticus str. Wang. GN=CY96_14000 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MWKDTIHSISSNLSLKNPATKDELTDIQKCLHVELPNDLYQLLQETNGIEGEYGDFIWSA
SKIKTENMSMRNIVDFKDLYMPFDCLLFFADGGNGDLFGYSILNGKVQRDDIYVWNHEND
SRTWVAPSLKTFMGWWESGKMII
Download sequence
Identical sequences A0A023P6L3 J7W1Z9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]