SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023PP53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023PP53
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Histone-fold 1.46e-43
Family Nucleosome core histones 0.00000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023PP53
Sequence length 105
Comment (tr|A0A023PP53|A0A023PP53_9ARAC) Histone H3 {ECO:0000256|RuleBase:RU004471} OX=1478093 OS=Sidymella angulata. GN= OC=Araneae; Araneomorphae; Entelegynae; Dionycha; Thomisidae; Sidymella.
Sequence
KAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVRE
IAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT
Download sequence
Identical sequences A0A023PP53 A0A0A7R5T5 A0A0A8LCI2 A0A0A8LE34 A0A0M3LP01 A0A142CGL1 L7QHF6 Q86R02 T2BC31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]