SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023UL31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023UL31
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.4e-82
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023UL31
Sequence length 155
Comment (tr|A0A023UL31|A0A023UL31_9EURY) Methyl-coenzyme M reductase alpha subunit {ECO:0000313|EMBL:AHY02707.1} OX=198240 OS=uncultured methanogenic archaeon. GN=mcrA OC=Archaea; Euryarchaeota; environmental samples.
Sequence
GGVGFTQYATAAYTDNILDDFTYFGQEYVEDKFGMAEAPNTMETVLDVGSEVTFYALEQF
EDYPALLETIFGGSQRASLVAAAAGCSTGFATGNAQSALSAWYLSMYLHKEQHARLGFYG
YDLQDQCGAANVFAIRGDEGLPLEARGANYPNYAM
Download sequence
Identical sequences A0A023UL31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]