SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023UPD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023UPD9
Domain Number 1 Region: 106-208
Classification Level Classification E-value
Superfamily Homing endonucleases 8.69e-23
Family Group I mobile intron endonuclease 0.02
Further Details:      
 
Domain Number 2 Region: 211-336
Classification Level Classification E-value
Superfamily Homing endonucleases 2.76e-18
Family Group I mobile intron endonuclease 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023UPD9
Sequence length 338
Comment (tr|A0A023UPD9|A0A023UPD9_MAGMU) Uncharacterized protein {ECO:0000313|EMBL:AHY04996.1} OX=43963 OS=Magnusiomyces magnusii (Yeast) (Dipodascus magnusii). GN=orf338 OC=Saccharomycetes; Saccharomycetales; Dipodascaceae; Magnusiomyces.
Sequence
QMAREYRMTILGNQTICVDLASLNRNANNSQITNARSWNQEFSHISVVFKSLVQWEHGIK
SMLVGISEAIRLILAVWIVPSKLNNTPARNFYNAANDPDKNPDPRKDPFNQWLAGVIDGD
GYFGLTKKGYTSCEITMETRDLVALENIRQKFGGSLKKRSGAKAYRWRMHNKKGVIRLIH
AVNGLIRNPIRLHQLSKICDKYAIPLQYAQNLSFKDGWFSGMIDSDGSIYYNPLSDQIFI
SVAQNNKYLLDELQKVYGGTVKPANSGQAFKYTVYKKAEIFNLINHYFSEFPLRTAKKIR
CDMIKDLYVVKSNKRSPMGSASFQEWFTFKDKWDNYKN
Download sequence
Identical sequences A0A023UPD9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]