SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023WZ42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023WZ42
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.02e-43
Family SMI1/KNR4-like 0.000000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023WZ42
Sequence length 135
Comment (tr|A0A023WZ42|A0A023WZ42_PSEST) Cell wall assembly protein {ECO:0000313|EMBL:AHY45025.1} KW=Complete proteome OX=316 OS=Pseudomonas stutzeri (Pseudomonas perfectomarina). GN=UIB01_22075 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEVIEQLRELNEPVPVPLELPDDDLLVEIEEQLLINLPFGLREFLLQVSDVIYGRLEPV
TATDPQSHTYLPEVAANAWDAGVPRDLIPLCQDGRDYYVVDLDGEVTLWDGDEAELTEET
WETVWHWARDVWLES
Download sequence
Identical sequences A0A023WZ42
WP_038665189.1.50587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]