SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023XAI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023XAI7
Domain Number 1 Region: 16-247
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.34e-54
Family Phosphate binding protein-like 0.0000245
Further Details:      
 
Domain Number 2 Region: 249-334
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.57e-20
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023XAI7
Sequence length 338
Comment (tr|A0A023XAI7|A0A023XAI7_BRAJP) Hydroxymethylbilane synthase {ECO:0000256|SAAS:SAAS00129903} KW=Complete proteome OX=476282 OS=Bradyrhizobium japonicum SEMIA 5079. GN=BJS_07262 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MRGKFAPRKEEDLATRFKIGTRKSAMALAQTEEIARRLTAAMPGLDVEIVKFDTTGDLDQ
TSKLLPHGGKGGAFVAQIRAAVLAGELQAAMHSLKDMPGNEDTPGLVIGATLSRDPPSDA
LVLREGVTLAALRQSRGEGFKIGTNAVRRAAYARRLFPDVEVIHFRGAADTRVRKLDNGE
KQRLPDGCAVGPADALIMARSGLDRVGLSSRIAYEFTAAEMLPAAGQGIVAVECAVQDWQ
TRKILSSIDDANAHLCADAEREVLWVLNGHCNSPIAGFSTIAGDQMSLTASVLDLSGNTI
IEASHTGPANRPRELGRAVGLDLLGKGAAEIIERSRPR
Download sequence
Identical sequences A0A023XAI7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]