SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023XT29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023XT29
Domain Number 1 Region: 273-402
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000405
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023XT29
Sequence length 437
Comment (tr|A0A023XT29|A0A023XT29_BRAJP) Uncharacterized protein {ECO:0000313|EMBL:AHY55488.1} KW=Complete proteome OX=476282 OS=Bradyrhizobium japonicum SEMIA 5079. GN=BJS_05015 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MYLAKFFHRAPGDDDRELMLVPGSDPMVIGVHMNWKGDPDANEFLRKKFPDIARAAATFR
RHVAKLVAAGYVETNHTNYTLRDLEPNPQAKPDWQKGLDELMILALSAPMAEQAAQLDAL
TGTPAEHEPLYLWHAARRDKVAGEDLAQAVRFAEQARDTLVARRAAGQPHYAWSIYEGDL
EGRILELLSDVYLQADNPEASLKTIEHLCKTAPNHTRILKRAELLCGYFPERREEAFDDA
YQWSRSGGYEDVMAFPGYAEYEAQRKAATSSKGWRWKPGTPASEADVSKAEQALGVRLPD
DYRKFLLTRGETELLVRLPESSSELRFYAPDELATQLRNVLDFIAHSEDELEEACAYFRQ
EYGVSLKHLVPVAEPSQLSRCLLLHVEPGDRYGQCFQWDHDGAWELEQPQPSLDVALKAL
TDGIERRDATQLAFFDL
Download sequence
Identical sequences A0A023XT29
WP_039155055.1.6944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]