SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023Y511 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023Y511
Domain Number 1 Region: 26-136
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000536
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023Y511
Sequence length 192
Comment (tr|A0A023Y511|A0A023Y511_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:AHY59409.1} KW=Complete proteome OX=216778 OS=Stenotrophomonas rhizophila. GN=DX03_12080 OC=Xanthomonadaceae; Stenotrophomonas.
Sequence
MHALHASFARFGPLKAQSTDLWQGDIALPSALAAFYTQVGSWGETVHASVGPVGISVPGV
NVAFPPLHRLWALQAGYRWEGDAGARIAEWPEQWLVIADQNADPFILDLDSGQVLFAFHG
AGTWEATVLTEDLPTFVAVLAAVGTVYLEAGDDLEDDDGELRPAHRDAALKAAAAVLGDD
EAADTFFETLEW
Download sequence
Identical sequences A0A023Y511
WP_038688992.1.55493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]