SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023Y9C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023Y9C7
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.21e-44
Family Regulator of G-protein signaling, RGS 0.000000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023Y9C7
Sequence length 270
Comment (tr|A0A023Y9C7|A0A023Y9C7_9PRIM) Axin 1-like protein {ECO:0000313|EMBL:AHY61143.1} OX=111174 OS=Galagoides zanzibaricus (Zanzibar galago). GN=AXIN1 OC=Lorisiformes; Galagidae; Galagoides.
Sequence
MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELASTDPRPVSHSFCSGKGAGIKGETSTAT
PRRADLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLARAIYRKYILDNSGIVSRQTKPATKSFIKDCIVKQQIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPT
LNEDEEWKCDQDLEEDGGRDPAPPSRLTQK
Download sequence
Identical sequences A0A023Y9C7 A0A023Y9U1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]