SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023YSU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023YSU7
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-24
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023YSU7
Sequence length 121
Comment (tr|A0A023YSU7|A0A023YSU7_ECOLX) Putative transcription factor {ECO:0000313|EMBL:AHY69057.1} KW=Complete proteome OX=1248823 OS=Escherichia coli O145:H28 str. RM12581. GN=ECRM12581_2635 OC=Enterobacteriaceae; Escherichia.
Sequence
MNDDLTLLRIILPAKPDLNCVTRFGGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGW
TPLLEAIVLNDGGIKQQAIVQLLLEHSASPHLTDKYGKTPLELARERGFEEIAQLLIAAG
A
Download sequence
Identical sequences A0A023YSU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]