SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023Z434 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023Z434
Domain Number 1 Region: 61-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000981
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023Z434
Sequence length 164
Comment (tr|A0A023Z434|A0A023Z434_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:AHY72866.1} KW=Complete proteome OX=1248823 OS=Escherichia coli O145:H28 str. RM12581. GN=ECRM12581_21680 OC=Enterobacteriaceae; Escherichia.
Sequence
MMTKTQINKLIKMMNDLDYPFEAPLKESFIESIIQIEFNSNSTNCLEKLCNEVSILFKNQ
PDYLTFLRAMDGFEVNGLRLFSLSIPEPSVKNLFAVNEFYRNNDDFINPDLQERLVIGDD
SISIFTYDIKSNFFEIRDNIGTENIFSSFSDFSSFLNEIMDSCS
Download sequence
Identical sequences A0A023Z434 A0A025CPC5 A0A026V6N7 A0A027U175 A0A027ZS94 A0A028E966 A0A070FEG7 A0A070UUI7 A0A073FP27 A0A074I9S9 A0A080FK52 A0A0A0FK26 A0A0A8UIU4 A0A0E1M2T1 A0A0E1T0J2 A0A0E2TML2 A0A142H7U8 A0A1S6TGR8 A0A1S9K7I3 A0A1X3IUX5 A0A1X3KXD0 A7ZSX6 B6I308 D7Y0J9 D8E7Y5 E1IP42 E9TFV4 F4NNG1 F4VK81 I2SW63 I2UIE6 I2WEW8 I2X1U6 K4VG32 K4XBJ9 L2VFG0 S1CL27 S1EKJ6 S1H5U0 S1IGV9 S1IN63 U9ZTP0 V2RTT4 V6FX18 V8FI42 W1AML1 W1F438 W1VAP5 W8STA3
gi|157162921|ref|YP_001460239.1| gi|157159360|ref|YP_001464905.1| gi|386706687|ref|YP_006170534.1| gi|544393171|ref|YP_008566585.1| 331111.EcE24377A_3922 331112.EcHS_A3642 409438.ECSE_3711 585034.ECIAI1_3588 WP_000988496.1.100066 WP_000988496.1.100159 WP_000988496.1.100185 WP_000988496.1.100251 WP_000988496.1.100252 WP_000988496.1.100283 WP_000988496.1.10034 WP_000988496.1.100346 WP_000988496.1.100425 WP_000988496.1.100444 WP_000988496.1.100451 WP_000988496.1.100571 WP_000988496.1.100573 WP_000988496.1.100614 WP_000988496.1.100667 WP_000988496.1.100689 WP_000988496.1.100718 WP_000988496.1.100753 WP_000988496.1.100758 WP_000988496.1.100796 WP_000988496.1.100803 WP_000988496.1.100836 WP_000988496.1.10086 WP_000988496.1.100867 WP_000988496.1.100868 WP_000988496.1.100928 WP_000988496.1.100933 WP_000988496.1.100990 WP_000988496.1.101102 WP_000988496.1.101157 WP_000988496.1.101216 WP_000988496.1.101257 WP_000988496.1.10126 WP_000988496.1.101293 WP_000988496.1.101387 WP_000988496.1.101468 WP_000988496.1.101518 WP_000988496.1.10154 WP_000988496.1.101583 WP_000988496.1.101630 WP_000988496.1.101651 WP_000988496.1.101653 WP_000988496.1.101668 WP_000988496.1.101686 WP_000988496.1.10173 WP_000988496.1.101777 WP_000988496.1.101786 WP_000988496.1.10184 WP_000988496.1.101840 WP_000988496.1.101865 WP_000988496.1.10187 WP_000988496.1.10190 WP_000988496.1.101913 WP_000988496.1.101947 WP_000988496.1.101952 WP_000988496.1.101969 WP_000988496.1.101987 WP_000988496.1.102069 WP_000988496.1.102122 WP_000988496.1.10235 WP_000988496.1.10304 WP_000988496.1.10379 WP_000988496.1.1040 WP_000988496.1.10400 WP_000988496.1.10461 WP_000988496.1.10496 WP_000988496.1.10524 WP_000988496.1.10538 WP_000988496.1.10579 WP_000988496.1.1058 WP_000988496.1.10607 WP_000988496.1.10673 WP_000988496.1.1073 WP_000988496.1.1074 WP_000988496.1.10763 WP_000988496.1.10798 WP_000988496.1.10824 WP_000988496.1.10922 WP_000988496.1.10940 WP_000988496.1.10989 WP_000988496.1.10994 WP_000988496.1.11006 WP_000988496.1.11032 WP_000988496.1.11052 WP_000988496.1.11091 WP_000988496.1.11133 WP_000988496.1.112 WP_000988496.1.1122 WP_000988496.1.11436 WP_000988496.1.11437 WP_000988496.1.11524 WP_000988496.1.11542 WP_000988496.1.11578 WP_000988496.1.11616 WP_000988496.1.11645 WP_000988496.1.11699 WP_000988496.1.11748 WP_000988496.1.11759 WP_000988496.1.11803 WP_000988496.1.11844 WP_000988496.1.1186 WP_000988496.1.11949 WP_000988496.1.1196 WP_000988496.1.11985 WP_000988496.1.12030 WP_000988496.1.12036 WP_000988496.1.12051 WP_000988496.1.12060 WP_000988496.1.12279 WP_000988496.1.12319 WP_000988496.1.12320 WP_000988496.1.12342 WP_000988496.1.12352 WP_000988496.1.1242 WP_000988496.1.12468 WP_000988496.1.12478 WP_000988496.1.12558 WP_000988496.1.12566 WP_000988496.1.12594 WP_000988496.1.12623 WP_000988496.1.12645 WP_000988496.1.12646 WP_000988496.1.12675 WP_000988496.1.12693 WP_000988496.1.12717 WP_000988496.1.12743 WP_000988496.1.12749 WP_000988496.1.1275 WP_000988496.1.12762 WP_000988496.1.12766 WP_000988496.1.12781 WP_000988496.1.12831 WP_000988496.1.12876 WP_000988496.1.12911 WP_000988496.1.1295 WP_000988496.1.12979 WP_000988496.1.13002 WP_000988496.1.13222 WP_000988496.1.1335 WP_000988496.1.13437 WP_000988496.1.13492 WP_000988496.1.13495 WP_000988496.1.13525 WP_000988496.1.13601 WP_000988496.1.13608 WP_000988496.1.13644 WP_000988496.1.13656 WP_000988496.1.13672 WP_000988496.1.13791 WP_000988496.1.13824 WP_000988496.1.13877 WP_000988496.1.13924 WP_000988496.1.13974 WP_000988496.1.14058 WP_000988496.1.14062 WP_000988496.1.14070 WP_000988496.1.1419 WP_000988496.1.14199 WP_000988496.1.14277 WP_000988496.1.14304 WP_000988496.1.1439 WP_000988496.1.14398 WP_000988496.1.14417 WP_000988496.1.14432 WP_000988496.1.14493 WP_000988496.1.14501 WP_000988496.1.14508 WP_000988496.1.14582 WP_000988496.1.14601 WP_000988496.1.14661 WP_000988496.1.14672 WP_000988496.1.14678 WP_000988496.1.14693 WP_000988496.1.1470 WP_000988496.1.14871 WP_000988496.1.14956 WP_000988496.1.14977 WP_000988496.1.15041 WP_000988496.1.15087 WP_000988496.1.1510 WP_000988496.1.15117 WP_000988496.1.15138 WP_000988496.1.15177 WP_000988496.1.15193 WP_000988496.1.15207 WP_000988496.1.15221 WP_000988496.1.1524 WP_000988496.1.15270 WP_000988496.1.15277 WP_000988496.1.15282 WP_000988496.1.15300 WP_000988496.1.15332 WP_000988496.1.15335 WP_000988496.1.15377 WP_000988496.1.15416 WP_000988496.1.1543 WP_000988496.1.15444 WP_000988496.1.15453 WP_000988496.1.15464 WP_000988496.1.15469 WP_000988496.1.15521 WP_000988496.1.15528 WP_000988496.1.15538 WP_000988496.1.15576 WP_000988496.1.15583 WP_000988496.1.15593 WP_000988496.1.1561 WP_000988496.1.15707 WP_000988496.1.15731 WP_000988496.1.15767 WP_000988496.1.15791 WP_000988496.1.1582 WP_000988496.1.15916 WP_000988496.1.15945 WP_000988496.1.15983 WP_000988496.1.16014 WP_000988496.1.16087 WP_000988496.1.16111 WP_000988496.1.16171 WP_000988496.1.16183 WP_000988496.1.16194 WP_000988496.1.1621 WP_000988496.1.16270 WP_000988496.1.163 WP_000988496.1.16387 WP_000988496.1.16388 WP_000988496.1.1640 WP_000988496.1.16435 WP_000988496.1.16500 WP_000988496.1.16517 WP_000988496.1.16539 WP_000988496.1.16541 WP_000988496.1.1655 WP_000988496.1.16612 WP_000988496.1.16648 WP_000988496.1.16682 WP_000988496.1.16700 WP_000988496.1.16715 WP_000988496.1.1673 WP_000988496.1.16745 WP_000988496.1.16805 WP_000988496.1.16861 WP_000988496.1.17017 WP_000988496.1.1710 WP_000988496.1.17102 WP_000988496.1.17109 WP_000988496.1.17111 WP_000988496.1.17119 WP_000988496.1.17123 WP_000988496.1.17170 WP_000988496.1.17182 WP_000988496.1.17216 WP_000988496.1.17241 WP_000988496.1.17242 WP_000988496.1.17267 WP_000988496.1.17282 WP_000988496.1.17297 WP_000988496.1.17356 WP_000988496.1.17360 WP_000988496.1.17373 WP_000988496.1.17392 WP_000988496.1.17403 WP_000988496.1.17417 WP_000988496.1.17464 WP_000988496.1.17550 WP_000988496.1.17595 WP_000988496.1.17623 WP_000988496.1.1763 WP_000988496.1.1766 WP_000988496.1.1769 WP_000988496.1.17766 WP_000988496.1.17802 WP_000988496.1.17829 WP_000988496.1.17831 WP_000988496.1.17920 WP_000988496.1.17961 WP_000988496.1.17963 WP_000988496.1.17984 WP_000988496.1.18000 WP_000988496.1.18064 WP_000988496.1.18094 WP_000988496.1.18134 WP_000988496.1.18164 WP_000988496.1.18229 WP_000988496.1.18275 WP_000988496.1.18329 WP_000988496.1.18338 WP_000988496.1.18436 WP_000988496.1.18438 WP_000988496.1.1844 WP_000988496.1.18458 WP_000988496.1.18482 WP_000988496.1.18530 WP_000988496.1.18588 WP_000988496.1.1866 WP_000988496.1.18666 WP_000988496.1.18699 WP_000988496.1.18714 WP_000988496.1.188 WP_000988496.1.18861 WP_000988496.1.18874 WP_000988496.1.18899 WP_000988496.1.18923 WP_000988496.1.18983 WP_000988496.1.1906 WP_000988496.1.19075 WP_000988496.1.19090 WP_000988496.1.19194 WP_000988496.1.19206 WP_000988496.1.1925 WP_000988496.1.19297 WP_000988496.1.19312 WP_000988496.1.19314 WP_000988496.1.19332 WP_000988496.1.19361 WP_000988496.1.19389 WP_000988496.1.19397 WP_000988496.1.19424 WP_000988496.1.19448 WP_000988496.1.19494 WP_000988496.1.19544 WP_000988496.1.19583 WP_000988496.1.19644 WP_000988496.1.19655 WP_000988496.1.19661 WP_000988496.1.19684 WP_000988496.1.19691 WP_000988496.1.19778 WP_000988496.1.19795 WP_000988496.1.19878 WP_000988496.1.20129 WP_000988496.1.20133 WP_000988496.1.2015 WP_000988496.1.20157 WP_000988496.1.20164 WP_000988496.1.20166 WP_000988496.1.20215 WP_000988496.1.20251 WP_000988496.1.20277 WP_000988496.1.20325 WP_000988496.1.20331 WP_000988496.1.20483 WP_000988496.1.20515 WP_000988496.1.20549 WP_000988496.1.20609 WP_000988496.1.20662 WP_000988496.1.20730 WP_000988496.1.20785 WP_000988496.1.20824 WP_000988496.1.2094 WP_000988496.1.20958 WP_000988496.1.21017 WP_000988496.1.21104 WP_000988496.1.21137 WP_000988496.1.21320 WP_000988496.1.21336 WP_000988496.1.21519 WP_000988496.1.2156 WP_000988496.1.21628 WP_000988496.1.21656 WP_000988496.1.21667 WP_000988496.1.21732 WP_000988496.1.21812 WP_000988496.1.21945 WP_000988496.1.21992 WP_000988496.1.22138 WP_000988496.1.22269 WP_000988496.1.22291 WP_000988496.1.22314 WP_000988496.1.22350 WP_000988496.1.22359 WP_000988496.1.22494 WP_000988496.1.22544 WP_000988496.1.22631 WP_000988496.1.22649 WP_000988496.1.22662 WP_000988496.1.22765 WP_000988496.1.22777 WP_000988496.1.22783 WP_000988496.1.22868 WP_000988496.1.2300 WP_000988496.1.23005 WP_000988496.1.23026 WP_000988496.1.23035 WP_000988496.1.23042 WP_000988496.1.23078 WP_000988496.1.23092 WP_000988496.1.23135 WP_000988496.1.23290 WP_000988496.1.23351 WP_000988496.1.23376 WP_000988496.1.23378 WP_000988496.1.23383 WP_000988496.1.23388 WP_000988496.1.23463 WP_000988496.1.23486 WP_000988496.1.23487 WP_000988496.1.23527 WP_000988496.1.23593 WP_000988496.1.2362 WP_000988496.1.23640 WP_000988496.1.23676 WP_000988496.1.23741 WP_000988496.1.23754 WP_000988496.1.23812 WP_000988496.1.23855 WP_000988496.1.23915 WP_000988496.1.23950 WP_000988496.1.24024 WP_000988496.1.24068 WP_000988496.1.24122 WP_000988496.1.24136 WP_000988496.1.24278 WP_000988496.1.2430 WP_000988496.1.24304 WP_000988496.1.24316 WP_000988496.1.24374 WP_000988496.1.24381 WP_000988496.1.24383 WP_000988496.1.24460 WP_000988496.1.24473 WP_000988496.1.24483 WP_000988496.1.24485 WP_000988496.1.24536 WP_000988496.1.24616 WP_000988496.1.24641 WP_000988496.1.24642 WP_000988496.1.24646 WP_000988496.1.24650 WP_000988496.1.24695 WP_000988496.1.2479 WP_000988496.1.24849 WP_000988496.1.24854 WP_000988496.1.24876 WP_000988496.1.24929 WP_000988496.1.24946 WP_000988496.1.24968 WP_000988496.1.24984 WP_000988496.1.25019 WP_000988496.1.25039 WP_000988496.1.2504 WP_000988496.1.25042 WP_000988496.1.25050 WP_000988496.1.25085 WP_000988496.1.25086 WP_000988496.1.25087 WP_000988496.1.25126 WP_000988496.1.25183 WP_000988496.1.25203 WP_000988496.1.2531 WP_000988496.1.25312 WP_000988496.1.25378 WP_000988496.1.25414 WP_000988496.1.2543 WP_000988496.1.25548 WP_000988496.1.2558 WP_000988496.1.25592 WP_000988496.1.25613 WP_000988496.1.25631 WP_000988496.1.25726 WP_000988496.1.25755 WP_000988496.1.25832 WP_000988496.1.2588 WP_000988496.1.25886 WP_000988496.1.25945 WP_000988496.1.25996 WP_000988496.1.26055 WP_000988496.1.26061 WP_000988496.1.26100 WP_000988496.1.26130 WP_000988496.1.26161 WP_000988496.1.26186 WP_000988496.1.26191 WP_000988496.1.26264 WP_000988496.1.26331 WP_000988496.1.2637 WP_000988496.1.26391 WP_000988496.1.26403 WP_000988496.1.26479 WP_000988496.1.26517 WP_000988496.1.26588 WP_000988496.1.26598 WP_000988496.1.26658 WP_000988496.1.26683 WP_000988496.1.26716 WP_000988496.1.26720 WP_000988496.1.26912 WP_000988496.1.26943 WP_000988496.1.27019 WP_000988496.1.27057 WP_000988496.1.27098 WP_000988496.1.27141 WP_000988496.1.27148 WP_000988496.1.27214 WP_000988496.1.27234 WP_000988496.1.27287 WP_000988496.1.27292 WP_000988496.1.2731 WP_000988496.1.27310 WP_000988496.1.27330 WP_000988496.1.27424 WP_000988496.1.27524 WP_000988496.1.27580 WP_000988496.1.27611 WP_000988496.1.27698 WP_000988496.1.27741 WP_000988496.1.27742 WP_000988496.1.27749 WP_000988496.1.27758 WP_000988496.1.27774 WP_000988496.1.27897 WP_000988496.1.27971 WP_000988496.1.2811 WP_000988496.1.28110 WP_000988496.1.28250 WP_000988496.1.2826 WP_000988496.1.28305 WP_000988496.1.28318 WP_000988496.1.28371 WP_000988496.1.28401 WP_000988496.1.28480 WP_000988496.1.28523 WP_000988496.1.28540 WP_000988496.1.28554 WP_000988496.1.28760 WP_000988496.1.28809 WP_000988496.1.28950 WP_000988496.1.28953 WP_000988496.1.290 WP_000988496.1.29001 WP_000988496.1.29016 WP_000988496.1.29026 WP_000988496.1.29055 WP_000988496.1.29082 WP_000988496.1.29100 WP_000988496.1.29118 WP_000988496.1.29125 WP_000988496.1.29202 WP_000988496.1.29206 WP_000988496.1.29239 WP_000988496.1.2926 WP_000988496.1.2942 WP_000988496.1.29495 WP_000988496.1.29503 WP_000988496.1.29504 WP_000988496.1.2954 WP_000988496.1.29590 WP_000988496.1.29669 WP_000988496.1.29689 WP_000988496.1.29715 WP_000988496.1.29724 WP_000988496.1.29798 WP_000988496.1.29840 WP_000988496.1.29874 WP_000988496.1.29876 WP_000988496.1.2995 WP_000988496.1.29967 WP_000988496.1.30004 WP_000988496.1.30098 WP_000988496.1.30105 WP_000988496.1.30123 WP_000988496.1.30399 WP_000988496.1.30428 WP_000988496.1.3045 WP_000988496.1.30554 WP_000988496.1.30742 WP_000988496.1.30783 WP_000988496.1.30853 WP_000988496.1.30866 WP_000988496.1.30906 WP_000988496.1.31000 WP_000988496.1.31142 WP_000988496.1.31295 WP_000988496.1.31319 WP_000988496.1.31340 WP_000988496.1.31347 WP_000988496.1.31357 WP_000988496.1.31429 WP_000988496.1.31506 WP_000988496.1.31518 WP_000988496.1.31521 WP_000988496.1.31709 WP_000988496.1.31740 WP_000988496.1.31803 WP_000988496.1.3181 WP_000988496.1.31835 WP_000988496.1.31860 WP_000988496.1.31866 WP_000988496.1.31898 WP_000988496.1.31924 WP_000988496.1.31928 WP_000988496.1.3193 WP_000988496.1.32089 WP_000988496.1.32091 WP_000988496.1.32093 WP_000988496.1.32094 WP_000988496.1.3212 WP_000988496.1.32138 WP_000988496.1.32142 WP_000988496.1.32184 WP_000988496.1.32232 WP_000988496.1.32234 WP_000988496.1.32236 WP_000988496.1.32287 WP_000988496.1.3233 WP_000988496.1.32394 WP_000988496.1.32406 WP_000988496.1.3247 WP_000988496.1.32475 WP_000988496.1.3248 WP_000988496.1.32494 WP_000988496.1.32561 WP_000988496.1.32655 WP_000988496.1.32661 WP_000988496.1.32680 WP_000988496.1.32709 WP_000988496.1.32722 WP_000988496.1.32724 WP_000988496.1.32811 WP_000988496.1.32815 WP_000988496.1.32831 WP_000988496.1.32875 WP_000988496.1.32910 WP_000988496.1.32946 WP_000988496.1.32972 WP_000988496.1.32992 WP_000988496.1.32995 WP_000988496.1.33004 WP_000988496.1.33014 WP_000988496.1.33119 WP_000988496.1.33238 WP_000988496.1.33244 WP_000988496.1.33385 WP_000988496.1.33422 WP_000988496.1.33475 WP_000988496.1.33512 WP_000988496.1.3354 WP_000988496.1.33667 WP_000988496.1.33680 WP_000988496.1.33745 WP_000988496.1.33751 WP_000988496.1.33823 WP_000988496.1.33948 WP_000988496.1.33952 WP_000988496.1.33974 WP_000988496.1.3411 WP_000988496.1.34122 WP_000988496.1.342 WP_000988496.1.34206 WP_000988496.1.34270 WP_000988496.1.34273 WP_000988496.1.34341 WP_000988496.1.34397 WP_000988496.1.34538 WP_000988496.1.34682 WP_000988496.1.347 WP_000988496.1.34727 WP_000988496.1.34781 WP_000988496.1.34794 WP_000988496.1.34982 WP_000988496.1.35114 WP_000988496.1.35180 WP_000988496.1.35195 WP_000988496.1.35202 WP_000988496.1.35204 WP_000988496.1.35211 WP_000988496.1.35316 WP_000988496.1.35365 WP_000988496.1.3539 WP_000988496.1.35464 WP_000988496.1.35466 WP_000988496.1.35468 WP_000988496.1.35552 WP_000988496.1.35604 WP_000988496.1.35653 WP_000988496.1.35704 WP_000988496.1.35740 WP_000988496.1.35922 WP_000988496.1.35927 WP_000988496.1.35934 WP_000988496.1.35942 WP_000988496.1.36070 WP_000988496.1.36071 WP_000988496.1.36085 WP_000988496.1.36094 WP_000988496.1.36166 WP_000988496.1.36177 WP_000988496.1.36207 WP_000988496.1.36332 WP_000988496.1.36334 WP_000988496.1.36412 WP_000988496.1.36426 WP_000988496.1.36496 WP_000988496.1.36507 WP_000988496.1.36627 WP_000988496.1.36707 WP_000988496.1.36739 WP_000988496.1.36806 WP_000988496.1.36817 WP_000988496.1.36826 WP_000988496.1.36925 WP_000988496.1.37046 WP_000988496.1.37099 WP_000988496.1.37206 WP_000988496.1.3723 WP_000988496.1.37252 WP_000988496.1.37334 WP_000988496.1.37352 WP_000988496.1.37371 WP_000988496.1.37472 WP_000988496.1.37476 WP_000988496.1.37510 WP_000988496.1.37538 WP_000988496.1.37548 WP_000988496.1.37554 WP_000988496.1.37634 WP_000988496.1.377 WP_000988496.1.3772 WP_000988496.1.37745 WP_000988496.1.37750 WP_000988496.1.37758 WP_000988496.1.37773 WP_000988496.1.37817 WP_000988496.1.37852 WP_000988496.1.3788 WP_000988496.1.37880 WP_000988496.1.37887 WP_000988496.1.37917 WP_000988496.1.37926 WP_000988496.1.37995 WP_000988496.1.38033 WP_000988496.1.38080 WP_000988496.1.38085 WP_000988496.1.38103 WP_000988496.1.38120 WP_000988496.1.38155 WP_000988496.1.38162 WP_000988496.1.38211 WP_000988496.1.3822 WP_000988496.1.38257 WP_000988496.1.38357 WP_000988496.1.38371 WP_000988496.1.38392 WP_000988496.1.38412 WP_000988496.1.38485 WP_000988496.1.38533 WP_000988496.1.38626 WP_000988496.1.38694 WP_000988496.1.38722 WP_000988496.1.3873 WP_000988496.1.38751 WP_000988496.1.38777 WP_000988496.1.38896 WP_000988496.1.38911 WP_000988496.1.38935 WP_000988496.1.39005 WP_000988496.1.3904 WP_000988496.1.39042 WP_000988496.1.39103 WP_000988496.1.39123 WP_000988496.1.39167 WP_000988496.1.39302 WP_000988496.1.39367 WP_000988496.1.39481 WP_000988496.1.39509 WP_000988496.1.3954 WP_000988496.1.39541 WP_000988496.1.39594 WP_000988496.1.39607 WP_000988496.1.39610 WP_000988496.1.39626 WP_000988496.1.39636 WP_000988496.1.3970 WP_000988496.1.39758 WP_000988496.1.39780 WP_000988496.1.3980 WP_000988496.1.39818 WP_000988496.1.39992 WP_000988496.1.40088 WP_000988496.1.40147 WP_000988496.1.4020 WP_000988496.1.40206 WP_000988496.1.40249 WP_000988496.1.40315 WP_000988496.1.40319 WP_000988496.1.40335 WP_000988496.1.40382 WP_000988496.1.40391 WP_000988496.1.40403 WP_000988496.1.4049 WP_000988496.1.40502 WP_000988496.1.40509 WP_000988496.1.40563 WP_000988496.1.40596 WP_000988496.1.40599 WP_000988496.1.40617 WP_000988496.1.40666 WP_000988496.1.40686 WP_000988496.1.40781 WP_000988496.1.40813 WP_000988496.1.4082 WP_000988496.1.40937 WP_000988496.1.41037 WP_000988496.1.41045 WP_000988496.1.41125 WP_000988496.1.41147 WP_000988496.1.41239 WP_000988496.1.41287 WP_000988496.1.41363 WP_000988496.1.41371 WP_000988496.1.41392 WP_000988496.1.41401 WP_000988496.1.41402 WP_000988496.1.4142 WP_000988496.1.41455 WP_000988496.1.41466 WP_000988496.1.41484 WP_000988496.1.41488 WP_000988496.1.41545 WP_000988496.1.41566 WP_000988496.1.41613 WP_000988496.1.41654 WP_000988496.1.41712 WP_000988496.1.4172 WP_000988496.1.41740 WP_000988496.1.41780 WP_000988496.1.41784 WP_000988496.1.41960 WP_000988496.1.41988 WP_000988496.1.42027 WP_000988496.1.42033 WP_000988496.1.42038 WP_000988496.1.42060 WP_000988496.1.42073 WP_000988496.1.42138 WP_000988496.1.4214 WP_000988496.1.42203 WP_000988496.1.42226 WP_000988496.1.4224 WP_000988496.1.42252 WP_000988496.1.42318 WP_000988496.1.42367 WP_000988496.1.42387 WP_000988496.1.42415 WP_000988496.1.42432 WP_000988496.1.42442 WP_000988496.1.42480 WP_000988496.1.42522 WP_000988496.1.42632 WP_000988496.1.42661 WP_000988496.1.42669 WP_000988496.1.42749 WP_000988496.1.42770 WP_000988496.1.4282 WP_000988496.1.42832 WP_000988496.1.42891 WP_000988496.1.4290 WP_000988496.1.42950 WP_000988496.1.42962 WP_000988496.1.42989 WP_000988496.1.43035 WP_000988496.1.43132 WP_000988496.1.43166 WP_000988496.1.43174 WP_000988496.1.43316 WP_000988496.1.43363 WP_000988496.1.4342 WP_000988496.1.43455 WP_000988496.1.43474 WP_000988496.1.43598 WP_000988496.1.43622 WP_000988496.1.43642 WP_000988496.1.43750 WP_000988496.1.43769 WP_000988496.1.43858 WP_000988496.1.43898 WP_000988496.1.43989 WP_000988496.1.44018 WP_000988496.1.44040 WP_000988496.1.44075 WP_000988496.1.44077 WP_000988496.1.44088 WP_000988496.1.4415 WP_000988496.1.44201 WP_000988496.1.44211 WP_000988496.1.44285 WP_000988496.1.44292 WP_000988496.1.44324 WP_000988496.1.44445 WP_000988496.1.44461 WP_000988496.1.44524 WP_000988496.1.44570 WP_000988496.1.44587 WP_000988496.1.44608 WP_000988496.1.44610 WP_000988496.1.44661 WP_000988496.1.4473 WP_000988496.1.44756 WP_000988496.1.44821 WP_000988496.1.44841 WP_000988496.1.44857 WP_000988496.1.44923 WP_000988496.1.44960 WP_000988496.1.44961 WP_000988496.1.44980 WP_000988496.1.45025 WP_000988496.1.45043 WP_000988496.1.45053 WP_000988496.1.45301 WP_000988496.1.45313 WP_000988496.1.45359 WP_000988496.1.45440 WP_000988496.1.45444 WP_000988496.1.4549 WP_000988496.1.45600 WP_000988496.1.45664 WP_000988496.1.4570 WP_000988496.1.45718 WP_000988496.1.45741 WP_000988496.1.45752 WP_000988496.1.45840 WP_000988496.1.45846 WP_000988496.1.45865 WP_000988496.1.45868 WP_000988496.1.4593 WP_000988496.1.45930 WP_000988496.1.45931 WP_000988496.1.45960 WP_000988496.1.45968 WP_000988496.1.4600 WP_000988496.1.46027 WP_000988496.1.46048 WP_000988496.1.46049 WP_000988496.1.46081 WP_000988496.1.46105 WP_000988496.1.4613 WP_000988496.1.46197 WP_000988496.1.46257 WP_000988496.1.46301 WP_000988496.1.46329 WP_000988496.1.46433 WP_000988496.1.46441 WP_000988496.1.4646 WP_000988496.1.4647 WP_000988496.1.46526 WP_000988496.1.46552 WP_000988496.1.46555 WP_000988496.1.46573 WP_000988496.1.46602 WP_000988496.1.46643 WP_000988496.1.46668 WP_000988496.1.46743 WP_000988496.1.46821 WP_000988496.1.46860 WP_000988496.1.46882 WP_000988496.1.46898 WP_000988496.1.46909 WP_000988496.1.4691 WP_000988496.1.46912 WP_000988496.1.46990 WP_000988496.1.46999 WP_000988496.1.47028 WP_000988496.1.47029 WP_000988496.1.47034 WP_000988496.1.47069 WP_000988496.1.47156 WP_000988496.1.47186 WP_000988496.1.47198 WP_000988496.1.47246 WP_000988496.1.47280 WP_000988496.1.47307 WP_000988496.1.47322 WP_000988496.1.47332 WP_000988496.1.47363 WP_000988496.1.47370 WP_000988496.1.47398 WP_000988496.1.4740 WP_000988496.1.47401 WP_000988496.1.47425 WP_000988496.1.47473 WP_000988496.1.47477 WP_000988496.1.47529 WP_000988496.1.47555 WP_000988496.1.47654 WP_000988496.1.47673 WP_000988496.1.47740 WP_000988496.1.47764 WP_000988496.1.47790 WP_000988496.1.47820 WP_000988496.1.4785 WP_000988496.1.48000 WP_000988496.1.48018 WP_000988496.1.48048 WP_000988496.1.48077 WP_000988496.1.48080 WP_000988496.1.48144 WP_000988496.1.48188 WP_000988496.1.48203 WP_000988496.1.48222 WP_000988496.1.48291 WP_000988496.1.48355 WP_000988496.1.48371 WP_000988496.1.48421 WP_000988496.1.48433 WP_000988496.1.48477 WP_000988496.1.48480 WP_000988496.1.48522 WP_000988496.1.48571 WP_000988496.1.486 WP_000988496.1.48615 WP_000988496.1.48678 WP_000988496.1.48771 WP_000988496.1.48801 WP_000988496.1.48847 WP_000988496.1.48901 WP_000988496.1.48921 WP_000988496.1.48926 WP_000988496.1.48928 WP_000988496.1.48954 WP_000988496.1.48970 WP_000988496.1.49107 WP_000988496.1.49147 WP_000988496.1.49229 WP_000988496.1.49243 WP_000988496.1.49275 WP_000988496.1.49312 WP_000988496.1.49336 WP_000988496.1.49459 WP_000988496.1.4949 WP_000988496.1.49546 WP_000988496.1.49558 WP_000988496.1.49599 WP_000988496.1.497 WP_000988496.1.49712 WP_000988496.1.49747 WP_000988496.1.49768 WP_000988496.1.49856 WP_000988496.1.49861 WP_000988496.1.49883 WP_000988496.1.49950 WP_000988496.1.50036 WP_000988496.1.50113 WP_000988496.1.50119 WP_000988496.1.50182 WP_000988496.1.50207 WP_000988496.1.50258 WP_000988496.1.50266 WP_000988496.1.50269 WP_000988496.1.50353 WP_000988496.1.50361 WP_000988496.1.50366 WP_000988496.1.5056 WP_000988496.1.50564 WP_000988496.1.50586 WP_000988496.1.50616 WP_000988496.1.5064 WP_000988496.1.5067 WP_000988496.1.50715 WP_000988496.1.50717 WP_000988496.1.50725 WP_000988496.1.50996 WP_000988496.1.51027 WP_000988496.1.51058 WP_000988496.1.5106 WP_000988496.1.51175 WP_000988496.1.51248 WP_000988496.1.51255 WP_000988496.1.51260 WP_000988496.1.51278 WP_000988496.1.51299 WP_000988496.1.51300 WP_000988496.1.51325 WP_000988496.1.51380 WP_000988496.1.51405 WP_000988496.1.51425 WP_000988496.1.51427 WP_000988496.1.51441 WP_000988496.1.5146 WP_000988496.1.51462 WP_000988496.1.51490 WP_000988496.1.51525 WP_000988496.1.51548 WP_000988496.1.5157 WP_000988496.1.51587 WP_000988496.1.51607 WP_000988496.1.51629 WP_000988496.1.51707 WP_000988496.1.51718 WP_000988496.1.51760 WP_000988496.1.51837 WP_000988496.1.51839 WP_000988496.1.51873 WP_000988496.1.51899 WP_000988496.1.51985 WP_000988496.1.51988 WP_000988496.1.52002 WP_000988496.1.52062 WP_000988496.1.52171 WP_000988496.1.52272 WP_000988496.1.52378 WP_000988496.1.5239 WP_000988496.1.52419 WP_000988496.1.52421 WP_000988496.1.52612 WP_000988496.1.5265 WP_000988496.1.52662 WP_000988496.1.52710 WP_000988496.1.52735 WP_000988496.1.52762 WP_000988496.1.52777 WP_000988496.1.52780 WP_000988496.1.52801 WP_000988496.1.52852 WP_000988496.1.52881 WP_000988496.1.52908 WP_000988496.1.52913 WP_000988496.1.52945 WP_000988496.1.52962 WP_000988496.1.52995 WP_000988496.1.53027 WP_000988496.1.53065 WP_000988496.1.5310 WP_000988496.1.53110 WP_000988496.1.53155 WP_000988496.1.53223 WP_000988496.1.53242 WP_000988496.1.53244 WP_000988496.1.53251 WP_000988496.1.53262 WP_000988496.1.53327 WP_000988496.1.53364 WP_000988496.1.53401 WP_000988496.1.53537 WP_000988496.1.53545 WP_000988496.1.53594 WP_000988496.1.5362 WP_000988496.1.53642 WP_000988496.1.53706 WP_000988496.1.53809 WP_000988496.1.53810 WP_000988496.1.53841 WP_000988496.1.53863 WP_000988496.1.5393 WP_000988496.1.53966 WP_000988496.1.53978 WP_000988496.1.54028 WP_000988496.1.54072 WP_000988496.1.54091 WP_000988496.1.54169 WP_000988496.1.54185 WP_000988496.1.54202 WP_000988496.1.54307 WP_000988496.1.54317 WP_000988496.1.54328 WP_000988496.1.54329 WP_000988496.1.54463 WP_000988496.1.54476 WP_000988496.1.54546 WP_000988496.1.54591 WP_000988496.1.5460 WP_000988496.1.54638 WP_000988496.1.54688 WP_000988496.1.54695 WP_000988496.1.5470 WP_000988496.1.54708 WP_000988496.1.54725 WP_000988496.1.54729 WP_000988496.1.5479 WP_000988496.1.54817 WP_000988496.1.54829 WP_000988496.1.54918 WP_000988496.1.54991 WP_000988496.1.55003 WP_000988496.1.55005 WP_000988496.1.55009 WP_000988496.1.55112 WP_000988496.1.55115 WP_000988496.1.55134 WP_000988496.1.55197 WP_000988496.1.5520 WP_000988496.1.55203 WP_000988496.1.55222 WP_000988496.1.55291 WP_000988496.1.55338 WP_000988496.1.55342 WP_000988496.1.55381 WP_000988496.1.55424 WP_000988496.1.55425 WP_000988496.1.55507 WP_000988496.1.55552 WP_000988496.1.55571 WP_000988496.1.55574 WP_000988496.1.55597 WP_000988496.1.5570 WP_000988496.1.55709 WP_000988496.1.55720 WP_000988496.1.55730 WP_000988496.1.55757 WP_000988496.1.55844 WP_000988496.1.55988 WP_000988496.1.561 WP_000988496.1.5616 WP_000988496.1.56177 WP_000988496.1.56193 WP_000988496.1.56197 WP_000988496.1.56216 WP_000988496.1.56231 WP_000988496.1.56285 WP_000988496.1.56302 WP_000988496.1.56371 WP_000988496.1.56390 WP_000988496.1.56399 WP_000988496.1.56439 WP_000988496.1.5646 WP_000988496.1.56513 WP_000988496.1.56543 WP_000988496.1.56665 WP_000988496.1.56680 WP_000988496.1.5670 WP_000988496.1.56704 WP_000988496.1.56721 WP_000988496.1.56742 WP_000988496.1.56786 WP_000988496.1.56799 WP_000988496.1.5685 WP_000988496.1.56932 WP_000988496.1.56980 WP_000988496.1.57072 WP_000988496.1.57086 WP_000988496.1.57100 WP_000988496.1.57185 WP_000988496.1.57216 WP_000988496.1.57222 WP_000988496.1.57281 WP_000988496.1.57403 WP_000988496.1.5748 WP_000988496.1.57487 WP_000988496.1.57538 WP_000988496.1.5755 WP_000988496.1.57629 WP_000988496.1.57638 WP_000988496.1.57659 WP_000988496.1.57719 WP_000988496.1.57738 WP_000988496.1.57812 WP_000988496.1.57904 WP_000988496.1.57920 WP_000988496.1.58001 WP_000988496.1.58022 WP_000988496.1.58045 WP_000988496.1.58060 WP_000988496.1.5810 WP_000988496.1.58143 WP_000988496.1.58146 WP_000988496.1.58163 WP_000988496.1.58172 WP_000988496.1.58206 WP_000988496.1.58226 WP_000988496.1.58289 WP_000988496.1.58340 WP_000988496.1.58371 WP_000988496.1.58384 WP_000988496.1.58445 WP_000988496.1.58514 WP_000988496.1.58528 WP_000988496.1.58547 WP_000988496.1.58572 WP_000988496.1.58582 WP_000988496.1.58622 WP_000988496.1.58705 WP_000988496.1.58837 WP_000988496.1.58870 WP_000988496.1.58940 WP_000988496.1.58958 WP_000988496.1.58977 WP_000988496.1.58983 WP_000988496.1.59026 WP_000988496.1.59047 WP_000988496.1.5906 WP_000988496.1.59083 WP_000988496.1.59174 WP_000988496.1.59190 WP_000988496.1.59199 WP_000988496.1.59280 WP_000988496.1.59293 WP_000988496.1.59302 WP_000988496.1.59409 WP_000988496.1.59413 WP_000988496.1.59434 WP_000988496.1.59533 WP_000988496.1.59638 WP_000988496.1.5965 WP_000988496.1.59699 WP_000988496.1.59717 WP_000988496.1.59737 WP_000988496.1.59782 WP_000988496.1.59791 WP_000988496.1.59836 WP_000988496.1.59858 WP_000988496.1.59877 WP_000988496.1.59912 WP_000988496.1.59932 WP_000988496.1.59989 WP_000988496.1.60023 WP_000988496.1.60067 WP_000988496.1.60070 WP_000988496.1.60095 WP_000988496.1.60151 WP_000988496.1.6022 WP_000988496.1.60343 WP_000988496.1.60436 WP_000988496.1.60457 WP_000988496.1.60477 WP_000988496.1.60491 WP_000988496.1.60498 WP_000988496.1.60576 WP_000988496.1.6059 WP_000988496.1.60606 WP_000988496.1.6064 WP_000988496.1.60698 WP_000988496.1.60732 WP_000988496.1.60832 WP_000988496.1.60835 WP_000988496.1.60895 WP_000988496.1.61005 WP_000988496.1.61035 WP_000988496.1.61058 WP_000988496.1.61097 WP_000988496.1.6110 WP_000988496.1.61102 WP_000988496.1.61112 WP_000988496.1.61174 WP_000988496.1.61181 WP_000988496.1.61225 WP_000988496.1.61241 WP_000988496.1.61292 WP_000988496.1.61512 WP_000988496.1.61636 WP_000988496.1.61758 WP_000988496.1.61770 WP_000988496.1.61806 WP_000988496.1.61926 WP_000988496.1.61939 WP_000988496.1.61948 WP_000988496.1.61957 WP_000988496.1.62041 WP_000988496.1.62264 WP_000988496.1.62282 WP_000988496.1.62290 WP_000988496.1.62337 WP_000988496.1.62447 WP_000988496.1.62460 WP_000988496.1.62487 WP_000988496.1.62514 WP_000988496.1.62529 WP_000988496.1.62642 WP_000988496.1.62646 WP_000988496.1.62668 WP_000988496.1.62681 WP_000988496.1.62714 WP_000988496.1.62818 WP_000988496.1.62840 WP_000988496.1.62850 WP_000988496.1.62851 WP_000988496.1.62931 WP_000988496.1.62973 WP_000988496.1.6299 WP_000988496.1.63177 WP_000988496.1.63246 WP_000988496.1.63370 WP_000988496.1.63374 WP_000988496.1.63437 WP_000988496.1.63466 WP_000988496.1.63467 WP_000988496.1.63470 WP_000988496.1.63478 WP_000988496.1.63484 WP_000988496.1.63491 WP_000988496.1.63536 WP_000988496.1.63576 WP_000988496.1.63679 WP_000988496.1.63721 WP_000988496.1.63746 WP_000988496.1.63810 WP_000988496.1.64014 WP_000988496.1.64050 WP_000988496.1.64074 WP_000988496.1.64080 WP_000988496.1.64110 WP_000988496.1.64150 WP_000988496.1.6416 WP_000988496.1.64175 WP_000988496.1.64193 WP_000988496.1.64286 WP_000988496.1.6431 WP_000988496.1.64355 WP_000988496.1.64356 WP_000988496.1.64380 WP_000988496.1.64391 WP_000988496.1.6441 WP_000988496.1.64438 WP_000988496.1.64458 WP_000988496.1.64657 WP_000988496.1.64693 WP_000988496.1.64707 WP_000988496.1.64749 WP_000988496.1.64926 WP_000988496.1.64970 WP_000988496.1.6499 WP_000988496.1.65023 WP_000988496.1.65040 WP_000988496.1.65155 WP_000988496.1.65179 WP_000988496.1.65256 WP_000988496.1.65305 WP_000988496.1.65306 WP_000988496.1.65408 WP_000988496.1.65413 WP_000988496.1.65415 WP_000988496.1.65493 WP_000988496.1.65531 WP_000988496.1.65581 WP_000988496.1.65708 WP_000988496.1.65762 WP_000988496.1.65912 WP_000988496.1.65962 WP_000988496.1.6599 WP_000988496.1.65991 WP_000988496.1.66001 WP_000988496.1.66007 WP_000988496.1.6604 WP_000988496.1.6609 WP_000988496.1.66094 WP_000988496.1.66121 WP_000988496.1.66127 WP_000988496.1.66181 WP_000988496.1.66251 WP_000988496.1.66280 WP_000988496.1.66288 WP_000988496.1.66412 WP_000988496.1.6645 WP_000988496.1.66579 WP_000988496.1.66624 WP_000988496.1.66644 WP_000988496.1.6665 WP_000988496.1.66758 WP_000988496.1.66783 WP_000988496.1.66796 WP_000988496.1.66849 WP_000988496.1.66926 WP_000988496.1.66948 WP_000988496.1.67018 WP_000988496.1.67102 WP_000988496.1.67120 WP_000988496.1.67209 WP_000988496.1.6723 WP_000988496.1.67272 WP_000988496.1.67278 WP_000988496.1.67293 WP_000988496.1.6735 WP_000988496.1.67451 WP_000988496.1.67452 WP_000988496.1.67468 WP_000988496.1.67522 WP_000988496.1.67553 WP_000988496.1.67581 WP_000988496.1.67660 WP_000988496.1.67663 WP_000988496.1.67701 WP_000988496.1.67724 WP_000988496.1.67732 WP_000988496.1.678 WP_000988496.1.67971 WP_000988496.1.68011 WP_000988496.1.68012 WP_000988496.1.6802 WP_000988496.1.68175 WP_000988496.1.682 WP_000988496.1.68241 WP_000988496.1.68255 WP_000988496.1.68278 WP_000988496.1.68283 WP_000988496.1.68300 WP_000988496.1.68347 WP_000988496.1.68442 WP_000988496.1.6860 WP_000988496.1.68609 WP_000988496.1.68673 WP_000988496.1.68678 WP_000988496.1.68695 WP_000988496.1.68751 WP_000988496.1.6877 WP_000988496.1.68801 WP_000988496.1.68865 WP_000988496.1.68873 WP_000988496.1.68915 WP_000988496.1.68956 WP_000988496.1.68989 WP_000988496.1.69033 WP_000988496.1.69098 WP_000988496.1.69126 WP_000988496.1.69127 WP_000988496.1.6923 WP_000988496.1.69247 WP_000988496.1.69258 WP_000988496.1.69390 WP_000988496.1.694 WP_000988496.1.69472 WP_000988496.1.69551 WP_000988496.1.69589 WP_000988496.1.69649 WP_000988496.1.69689 WP_000988496.1.69786 WP_000988496.1.6993 WP_000988496.1.69972 WP_000988496.1.70063 WP_000988496.1.70200 WP_000988496.1.70213 WP_000988496.1.70357 WP_000988496.1.70370 WP_000988496.1.70477 WP_000988496.1.7052 WP_000988496.1.70582 WP_000988496.1.70592 WP_000988496.1.70628 WP_000988496.1.70694 WP_000988496.1.70705 WP_000988496.1.70745 WP_000988496.1.70748 WP_000988496.1.70801 WP_000988496.1.70803 WP_000988496.1.70967 WP_000988496.1.71042 WP_000988496.1.71062 WP_000988496.1.71109 WP_000988496.1.71113 WP_000988496.1.71134 WP_000988496.1.71147 WP_000988496.1.71272 WP_000988496.1.71275 WP_000988496.1.71285 WP_000988496.1.71315 WP_000988496.1.71327 WP_000988496.1.71339 WP_000988496.1.71354 WP_000988496.1.71403 WP_000988496.1.71522 WP_000988496.1.71537 WP_000988496.1.71540 WP_000988496.1.71632 WP_000988496.1.71680 WP_000988496.1.71695 WP_000988496.1.71712 WP_000988496.1.71757 WP_000988496.1.71767 WP_000988496.1.71783 WP_000988496.1.71856 WP_000988496.1.71874 WP_000988496.1.7192 WP_000988496.1.72013 WP_000988496.1.72021 WP_000988496.1.72033 WP_000988496.1.7205 WP_000988496.1.72053 WP_000988496.1.72090 WP_000988496.1.72125 WP_000988496.1.72141 WP_000988496.1.72153 WP_000988496.1.72240 WP_000988496.1.72261 WP_000988496.1.72270 WP_000988496.1.72279 WP_000988496.1.72431 WP_000988496.1.72493 WP_000988496.1.72521 WP_000988496.1.72522 WP_000988496.1.72535 WP_000988496.1.72544 WP_000988496.1.72608 WP_000988496.1.72643 WP_000988496.1.72695 WP_000988496.1.72725 WP_000988496.1.72729 WP_000988496.1.72745 WP_000988496.1.72751 WP_000988496.1.72758 WP_000988496.1.72764 WP_000988496.1.7277 WP_000988496.1.72837 WP_000988496.1.72858 WP_000988496.1.72947 WP_000988496.1.73010 WP_000988496.1.73032 WP_000988496.1.7307 WP_000988496.1.73072 WP_000988496.1.73075 WP_000988496.1.73197 WP_000988496.1.73230 WP_000988496.1.73239 WP_000988496.1.73243 WP_000988496.1.73251 WP_000988496.1.73257 WP_000988496.1.73259 WP_000988496.1.73292 WP_000988496.1.73326 WP_000988496.1.73349 WP_000988496.1.73428 WP_000988496.1.73468 WP_000988496.1.7349 WP_000988496.1.73604 WP_000988496.1.73663 WP_000988496.1.73700 WP_000988496.1.73709 WP_000988496.1.7376 WP_000988496.1.73797 WP_000988496.1.73807 WP_000988496.1.73827 WP_000988496.1.73843 WP_000988496.1.73882 WP_000988496.1.73897 WP_000988496.1.73995 WP_000988496.1.73996 WP_000988496.1.74051 WP_000988496.1.7413 WP_000988496.1.74156 WP_000988496.1.74184 WP_000988496.1.7425 WP_000988496.1.74423 WP_000988496.1.74431 WP_000988496.1.74478 WP_000988496.1.74491 WP_000988496.1.74501 WP_000988496.1.74513 WP_000988496.1.74520 WP_000988496.1.74624 WP_000988496.1.74670 WP_000988496.1.74687 WP_000988496.1.74689 WP_000988496.1.74705 WP_000988496.1.74752 WP_000988496.1.7478 WP_000988496.1.74811 WP_000988496.1.74844 WP_000988496.1.74852 WP_000988496.1.74860 WP_000988496.1.74885 WP_000988496.1.74889 WP_000988496.1.74895 WP_000988496.1.74998 WP_000988496.1.75029 WP_000988496.1.75050 WP_000988496.1.75112 WP_000988496.1.75145 WP_000988496.1.75149 WP_000988496.1.75181 WP_000988496.1.75209 WP_000988496.1.75254 WP_000988496.1.75270 WP_000988496.1.75272 WP_000988496.1.75360 WP_000988496.1.75367 WP_000988496.1.75428 WP_000988496.1.75435 WP_000988496.1.75465 WP_000988496.1.75529 WP_000988496.1.75588 WP_000988496.1.75629 WP_000988496.1.75672 WP_000988496.1.75676 WP_000988496.1.75687 WP_000988496.1.75696 WP_000988496.1.75735 WP_000988496.1.75853 WP_000988496.1.7597 WP_000988496.1.75973 WP_000988496.1.75983 WP_000988496.1.76009 WP_000988496.1.7603 WP_000988496.1.76036 WP_000988496.1.76039 WP_000988496.1.76087 WP_000988496.1.76103 WP_000988496.1.76184 WP_000988496.1.76361 WP_000988496.1.76376 WP_000988496.1.76384 WP_000988496.1.76387 WP_000988496.1.76390 WP_000988496.1.76542 WP_000988496.1.76547 WP_000988496.1.76562 WP_000988496.1.76595 WP_000988496.1.7661 WP_000988496.1.76619 WP_000988496.1.76707 WP_000988496.1.76712 WP_000988496.1.76840 WP_000988496.1.76909 WP_000988496.1.76948 WP_000988496.1.76965 WP_000988496.1.76966 WP_000988496.1.7699 WP_000988496.1.77015 WP_000988496.1.77022 WP_000988496.1.77070 WP_000988496.1.77109 WP_000988496.1.77147 WP_000988496.1.77163 WP_000988496.1.77173 WP_000988496.1.77175 WP_000988496.1.77255 WP_000988496.1.77258 WP_000988496.1.77291 WP_000988496.1.7731 WP_000988496.1.77341 WP_000988496.1.77470 WP_000988496.1.77477 WP_000988496.1.77495 WP_000988496.1.77581 WP_000988496.1.77608 WP_000988496.1.77626 WP_000988496.1.77767 WP_000988496.1.7781 WP_000988496.1.77826 WP_000988496.1.77833 WP_000988496.1.77929 WP_000988496.1.77949 WP_000988496.1.78007 WP_000988496.1.78099 WP_000988496.1.78102 WP_000988496.1.78235 WP_000988496.1.78297 WP_000988496.1.78323 WP_000988496.1.78337 WP_000988496.1.78481 WP_000988496.1.78515 WP_000988496.1.78586 WP_000988496.1.78610 WP_000988496.1.78683 WP_000988496.1.78698 WP_000988496.1.78757 WP_000988496.1.78775 WP_000988496.1.78791 WP_000988496.1.78843 WP_000988496.1.78854 WP_000988496.1.78888 WP_000988496.1.78891 WP_000988496.1.78919 WP_000988496.1.7896 WP_000988496.1.78966 WP_000988496.1.7898 WP_000988496.1.79065 WP_000988496.1.79075 WP_000988496.1.79306 WP_000988496.1.79312 WP_000988496.1.79343 WP_000988496.1.79346 WP_000988496.1.79369 WP_000988496.1.7937 WP_000988496.1.79391 WP_000988496.1.79478 WP_000988496.1.79525 WP_000988496.1.79526 WP_000988496.1.79540 WP_000988496.1.79606 WP_000988496.1.79685 WP_000988496.1.79713 WP_000988496.1.79800 WP_000988496.1.79824 WP_000988496.1.7985 WP_000988496.1.79866 WP_000988496.1.79905 WP_000988496.1.79930 WP_000988496.1.79931 WP_000988496.1.79932 WP_000988496.1.80060 WP_000988496.1.8007 WP_000988496.1.80071 WP_000988496.1.80106 WP_000988496.1.80112 WP_000988496.1.80141 WP_000988496.1.80176 WP_000988496.1.80179 WP_000988496.1.80310 WP_000988496.1.80402 WP_000988496.1.80426 WP_000988496.1.80484 WP_000988496.1.80612 WP_000988496.1.80626 WP_000988496.1.80662 WP_000988496.1.80666 WP_000988496.1.80709 WP_000988496.1.80737 WP_000988496.1.80753 WP_000988496.1.80754 WP_000988496.1.80789 WP_000988496.1.80894 WP_000988496.1.80945 WP_000988496.1.80946 WP_000988496.1.80983 WP_000988496.1.80985 WP_000988496.1.810 WP_000988496.1.81054 WP_000988496.1.811 WP_000988496.1.81104 WP_000988496.1.81165 WP_000988496.1.81182 WP_000988496.1.81219 WP_000988496.1.81316 WP_000988496.1.81376 WP_000988496.1.81391 WP_000988496.1.81438 WP_000988496.1.81469 WP_000988496.1.81475 WP_000988496.1.81484 WP_000988496.1.81517 WP_000988496.1.81576 WP_000988496.1.81589 WP_000988496.1.81596 WP_000988496.1.81618 WP_000988496.1.81625 WP_000988496.1.8172 WP_000988496.1.81869 WP_000988496.1.81914 WP_000988496.1.81935 WP_000988496.1.81972 WP_000988496.1.82 WP_000988496.1.82059 WP_000988496.1.82062 WP_000988496.1.82137 WP_000988496.1.82217 WP_000988496.1.82239 WP_000988496.1.82242 WP_000988496.1.82246 WP_000988496.1.82275 WP_000988496.1.82326 WP_000988496.1.82378 WP_000988496.1.82536 WP_000988496.1.82572 WP_000988496.1.82661 WP_000988496.1.82682 WP_000988496.1.82691 WP_000988496.1.82711 WP_000988496.1.82718 WP_000988496.1.8277 WP_000988496.1.82831 WP_000988496.1.82902 WP_000988496.1.83035 WP_000988496.1.8306 WP_000988496.1.83093 WP_000988496.1.83097 WP_000988496.1.83144 WP_000988496.1.83205 WP_000988496.1.83347 WP_000988496.1.83415 WP_000988496.1.8345 WP_000988496.1.83481 WP_000988496.1.83544 WP_000988496.1.83564 WP_000988496.1.83684 WP_000988496.1.83762 WP_000988496.1.83781 WP_000988496.1.84060 WP_000988496.1.84140 WP_000988496.1.84172 WP_000988496.1.84210 WP_000988496.1.84298 WP_000988496.1.84313 WP_000988496.1.84339 WP_000988496.1.84348 WP_000988496.1.84436 WP_000988496.1.84473 WP_000988496.1.84511 WP_000988496.1.84656 WP_000988496.1.8470 WP_000988496.1.84797 WP_000988496.1.84850 WP_000988496.1.84875 WP_000988496.1.84877 WP_000988496.1.84881 WP_000988496.1.84893 WP_000988496.1.84894 WP_000988496.1.84941 WP_000988496.1.85011 WP_000988496.1.85052 WP_000988496.1.85090 WP_000988496.1.85098 WP_000988496.1.85105 WP_000988496.1.85112 WP_000988496.1.85129 WP_000988496.1.85175 WP_000988496.1.85342 WP_000988496.1.85435 WP_000988496.1.85500 WP_000988496.1.85657 WP_000988496.1.85762 WP_000988496.1.85806 WP_000988496.1.85857 WP_000988496.1.85939 WP_000988496.1.85944 WP_000988496.1.86016 WP_000988496.1.86035 WP_000988496.1.8607 WP_000988496.1.86110 WP_000988496.1.86115 WP_000988496.1.86149 WP_000988496.1.86181 WP_000988496.1.86189 WP_000988496.1.86263 WP_000988496.1.86266 WP_000988496.1.86276 WP_000988496.1.86283 WP_000988496.1.86307 WP_000988496.1.86355 WP_000988496.1.86364 WP_000988496.1.86371 WP_000988496.1.86376 WP_000988496.1.86393 WP_000988496.1.86411 WP_000988496.1.86451 WP_000988496.1.86452 WP_000988496.1.86454 WP_000988496.1.86492 WP_000988496.1.8652 WP_000988496.1.86583 WP_000988496.1.86598 WP_000988496.1.86617 WP_000988496.1.86640 WP_000988496.1.86667 WP_000988496.1.86674 WP_000988496.1.86681 WP_000988496.1.86707 WP_000988496.1.86833 WP_000988496.1.86848 WP_000988496.1.86956 WP_000988496.1.87075 WP_000988496.1.87109 WP_000988496.1.8711 WP_000988496.1.87189 WP_000988496.1.87249 WP_000988496.1.87310 WP_000988496.1.87358 WP_000988496.1.87400 WP_000988496.1.87410 WP_000988496.1.87465 WP_000988496.1.87557 WP_000988496.1.87563 WP_000988496.1.87568 WP_000988496.1.87607 WP_000988496.1.87610 WP_000988496.1.87639 WP_000988496.1.87694 WP_000988496.1.87728 WP_000988496.1.87788 WP_000988496.1.87789 WP_000988496.1.87822 WP_000988496.1.87914 WP_000988496.1.87919 WP_000988496.1.87973 WP_000988496.1.87976 WP_000988496.1.87980 WP_000988496.1.88020 WP_000988496.1.88088 WP_000988496.1.88149 WP_000988496.1.88155 WP_000988496.1.88238 WP_000988496.1.88252 WP_000988496.1.88285 WP_000988496.1.88301 WP_000988496.1.88304 WP_000988496.1.88376 WP_000988496.1.88384 WP_000988496.1.88427 WP_000988496.1.88462 WP_000988496.1.88535 WP_000988496.1.88539 WP_000988496.1.88598 WP_000988496.1.88631 WP_000988496.1.88646 WP_000988496.1.88667 WP_000988496.1.88709 WP_000988496.1.88710 WP_000988496.1.88711 WP_000988496.1.88732 WP_000988496.1.88757 WP_000988496.1.88759 WP_000988496.1.88883 WP_000988496.1.88950 WP_000988496.1.89050 WP_000988496.1.8906 WP_000988496.1.89067 WP_000988496.1.89165 WP_000988496.1.89183 WP_000988496.1.89200 WP_000988496.1.89255 WP_000988496.1.894 WP_000988496.1.89432 WP_000988496.1.8945 WP_000988496.1.89474 WP_000988496.1.89479 WP_000988496.1.89492 WP_000988496.1.89601 WP_000988496.1.89646 WP_000988496.1.89679 WP_000988496.1.89710 WP_000988496.1.89768 WP_000988496.1.89818 WP_000988496.1.89839 WP_000988496.1.89859 WP_000988496.1.89895 WP_000988496.1.89915 WP_000988496.1.89918 WP_000988496.1.89920 WP_000988496.1.89927 WP_000988496.1.89977 WP_000988496.1.90063 WP_000988496.1.9009 WP_000988496.1.9010 WP_000988496.1.90156 WP_000988496.1.90266 WP_000988496.1.90389 WP_000988496.1.90405 WP_000988496.1.90435 WP_000988496.1.90441 WP_000988496.1.90467 WP_000988496.1.90547 WP_000988496.1.9059 WP_000988496.1.9061 WP_000988496.1.90626 WP_000988496.1.90799 WP_000988496.1.90813 WP_000988496.1.90822 WP_000988496.1.90828 WP_000988496.1.90834 WP_000988496.1.90839 WP_000988496.1.90856 WP_000988496.1.90873 WP_000988496.1.90890 WP_000988496.1.90979 WP_000988496.1.91 WP_000988496.1.91018 WP_000988496.1.91094 WP_000988496.1.91121 WP_000988496.1.91266 WP_000988496.1.91268 WP_000988496.1.91397 WP_000988496.1.91485 WP_000988496.1.915 WP_000988496.1.91511 WP_000988496.1.91516 WP_000988496.1.91565 WP_000988496.1.9157 WP_000988496.1.91596 WP_000988496.1.9160 WP_000988496.1.91640 WP_000988496.1.91643 WP_000988496.1.91672 WP_000988496.1.91685 WP_000988496.1.9171 WP_000988496.1.91782 WP_000988496.1.91787 WP_000988496.1.91850 WP_000988496.1.91959 WP_000988496.1.92005 WP_000988496.1.92014 WP_000988496.1.92031 WP_000988496.1.92048 WP_000988496.1.92058 WP_000988496.1.921 WP_000988496.1.92102 WP_000988496.1.92163 WP_000988496.1.92215 WP_000988496.1.92311 WP_000988496.1.92323 WP_000988496.1.92361 WP_000988496.1.92434 WP_000988496.1.92532 WP_000988496.1.9255 WP_000988496.1.92577 WP_000988496.1.9264 WP_000988496.1.92693 WP_000988496.1.92708 WP_000988496.1.92719 WP_000988496.1.92780 WP_000988496.1.92781 WP_000988496.1.92792 WP_000988496.1.92865 WP_000988496.1.92989 WP_000988496.1.93005 WP_000988496.1.93016 WP_000988496.1.93033 WP_000988496.1.93072 WP_000988496.1.93100 WP_000988496.1.93112 WP_000988496.1.93133 WP_000988496.1.9327 WP_000988496.1.93309 WP_000988496.1.93338 WP_000988496.1.93379 WP_000988496.1.93388 WP_000988496.1.93463 WP_000988496.1.93531 WP_000988496.1.93569 WP_000988496.1.93621 WP_000988496.1.93629 WP_000988496.1.93665 WP_000988496.1.93733 WP_000988496.1.93743 WP_000988496.1.93745 WP_000988496.1.93800 WP_000988496.1.93873 WP_000988496.1.93877 WP_000988496.1.93918 WP_000988496.1.93971 WP_000988496.1.94008 WP_000988496.1.94156 WP_000988496.1.94187 WP_000988496.1.94232 WP_000988496.1.94298 WP_000988496.1.94317 WP_000988496.1.94353 WP_000988496.1.94404 WP_000988496.1.94468 WP_000988496.1.94475 WP_000988496.1.94507 WP_000988496.1.94542 WP_000988496.1.94580 WP_000988496.1.94626 WP_000988496.1.94646 WP_000988496.1.94695 WP_000988496.1.94787 WP_000988496.1.94822 WP_000988496.1.94836 WP_000988496.1.94880 WP_000988496.1.94889 WP_000988496.1.94903 WP_000988496.1.9491 WP_000988496.1.94938 WP_000988496.1.94993 WP_000988496.1.95005 WP_000988496.1.95022 WP_000988496.1.95037 WP_000988496.1.95062 WP_000988496.1.9513 WP_000988496.1.95161 WP_000988496.1.95243 WP_000988496.1.95244 WP_000988496.1.95275 WP_000988496.1.95368 WP_000988496.1.95381 WP_000988496.1.95400 WP_000988496.1.95424 WP_000988496.1.95490 WP_000988496.1.95518 WP_000988496.1.95521 WP_000988496.1.95563 WP_000988496.1.9559 WP_000988496.1.95604 WP_000988496.1.95634 WP_000988496.1.95771 WP_000988496.1.95800 WP_000988496.1.95824 WP_000988496.1.95869 WP_000988496.1.95916 WP_000988496.1.95931 WP_000988496.1.95932 WP_000988496.1.96053 WP_000988496.1.96086 WP_000988496.1.96114 WP_000988496.1.96177 WP_000988496.1.96222 WP_000988496.1.96229 WP_000988496.1.96247 WP_000988496.1.96278 WP_000988496.1.96417 WP_000988496.1.96457 WP_000988496.1.96479 WP_000988496.1.96494 WP_000988496.1.965 WP_000988496.1.96541 WP_000988496.1.96585 WP_000988496.1.96659 WP_000988496.1.9668 WP_000988496.1.96743 WP_000988496.1.96817 WP_000988496.1.9690 WP_000988496.1.9691 WP_000988496.1.96924 WP_000988496.1.96984 WP_000988496.1.97049 WP_000988496.1.97059 WP_000988496.1.97119 WP_000988496.1.97200 WP_000988496.1.97248 WP_000988496.1.97344 WP_000988496.1.97351 WP_000988496.1.97356 WP_000988496.1.97361 WP_000988496.1.97421 WP_000988496.1.97434 WP_000988496.1.97439 WP_000988496.1.97459 WP_000988496.1.97544 WP_000988496.1.97560 WP_000988496.1.97667 WP_000988496.1.97685 WP_000988496.1.97705 WP_000988496.1.97825 WP_000988496.1.97930 WP_000988496.1.97932 WP_000988496.1.97937 WP_000988496.1.97962 WP_000988496.1.97996 WP_000988496.1.98026 WP_000988496.1.9803 WP_000988496.1.98082 WP_000988496.1.98115 WP_000988496.1.9816 WP_000988496.1.9817 WP_000988496.1.98202 WP_000988496.1.98232 WP_000988496.1.98241 WP_000988496.1.98244 WP_000988496.1.98292 WP_000988496.1.98301 WP_000988496.1.98357 WP_000988496.1.98400 WP_000988496.1.98404 WP_000988496.1.98451 WP_000988496.1.98549 WP_000988496.1.98578 WP_000988496.1.98614 WP_000988496.1.98654 WP_000988496.1.98665 WP_000988496.1.98683 WP_000988496.1.98702 WP_000988496.1.98875 WP_000988496.1.98988 WP_000988496.1.99029 WP_000988496.1.99168 WP_000988496.1.99246 WP_000988496.1.99265 WP_000988496.1.99295 WP_000988496.1.99302 WP_000988496.1.99310 WP_000988496.1.99334 WP_000988496.1.99361 WP_000988496.1.99392 WP_000988496.1.99471 WP_000988496.1.99475 WP_000988496.1.99486 WP_000988496.1.99511 WP_000988496.1.99603 WP_000988496.1.99619 WP_000988496.1.99632 WP_000988496.1.99666 WP_000988496.1.99804 WP_000988496.1.99827 WP_000988496.1.99869 WP_000988496.1.99929 gi|209920902|ref|YP_002294986.1| gi|378711130|ref|YP_005276023.1| gi|378711130|ref|YP_005276023.1| gi|218555993|ref|YP_002388906.1| gi|386711324|ref|YP_006175045.1| gi|386711324|ref|YP_006175045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]