SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023Z7H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023Z7H0
Domain Number - Region: 117-166
Classification Level Classification E-value
Superfamily GAT-like domain 0.0228
Family GAT domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023Z7H0
Sequence length 219
Comment (tr|A0A023Z7H0|A0A023Z7H0_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:AHY74026.1} KW=Complete proteome OX=1248823 OS=Escherichia coli O145:H28 str. RM12581. GN=ECRM12581_27480 OC=Enterobacteriaceae; Escherichia.
Sequence
MRYSMAVMQRHIEHDKRRPLPLVIPMLFYHGSRSPYPWSLCWLDAFADPTTARKLYTAAF
PLVDVTVVPDDEIVQHRRVALLELIQKHIRQRDLMGLIDQLAVLLVTGCANDSQITALLN
YILLAGDEASFKEFISELTSRMPQHRERIMTIAERIHNDGWLLGMVKGKEEGEQRLLRLL
LQNGADPEWIQRYTGLSAEQMQALEQPLPESKRDPWIEY
Download sequence
Identical sequences A0A023Z7H0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]