SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024BUT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024BUT8
Domain Number 1 Region: 3-213
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.33e-72
Family Phosphate binding protein-like 0.00000393
Further Details:      
 
Domain Number 2 Region: 217-303
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.83e-20
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024BUT8
Sequence length 306
Comment (tr|A0A024BUT8|A0A024BUT8_HELPX) Pre-uroporphyrinogen synthase {ECO:0000256|HAMAP-Rule:MF_00260} KW=Complete proteome OX=102611 OS=Helicobacter pylori J166. GN=EG65_01250 OC=Helicobacteraceae; Helicobacter.
Sequence
MGNLVIGSRGSELALWQANHIKERLKKECLIESEIQIVKTKGDKILDTPLNKIGGKGLFT
KELEELLLKGEIDLAVHSLKDVPVVFEKGLDLACITKRADVRDTFLSVKFPDLMSLPKGA
KVGTTSLRRSMQIKLKRQDLDTESLRGNVQTRLKKLECGEFDAIILAEAGLCRLEIQGAK
YRKAFSVEEMIPSMGQGALGVEMLKNHKHFITLQKLNDEESAFCCHLEREFIKGLNGGCQ
IPIGVHASLMGDRVKIQAVLGLPNGKEVITKEKQGDKTRAFDLVQELLEEFLQSGAKEIL
EKAQLF
Download sequence
Identical sequences A0A024BUT8
WP_026937930.1.12724 WP_026937930.1.15236 WP_026937930.1.24415 WP_026937930.1.28441 WP_026937930.1.33843 WP_026937930.1.36370 WP_026937930.1.41526 WP_026937930.1.4357 WP_026937930.1.48214 WP_026937930.1.49489 WP_026937930.1.53584 WP_026937930.1.76936 WP_026937930.1.83208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]